DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and CG15696

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster


Alignment Length:184 Identity:50/184 - (27%)
Similarity:71/184 - (38%) Gaps:53/184 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 GSGASNGVL------YPNAPYTDHGFLQMTLGYLSPSSG------------------TYKSVDPY 235
            |:.||.|||      .|..||..      ...|:|..||                  .|....|.
  Fly    19 GTNASLGVLQRLRASLPFHPYAH------PASYVSKESGGSPPASAAEAQIPVYDWLQYTRYHPP 77

  Fly   236 FLSQASLFGGAPFFGAPGCVPELALGLGMGVNALRHCRRRKARTVFSDPQLSGLEKRFEGQRYLS 300
            .|.:| |...||....||.:|                     |..|:..||..||..::...|||
  Fly    78 KLPRA-LRQNAPAKRTPGRLP---------------------RIPFTPQQLQALENAYKESNYLS 120

  Fly   301 TPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRDNANEPVDFSRSEPGKQP 354
            ..:..:||.:|.|:.|:||.||||||.:.:::.|.:|.:.:.. ||.:....:|
  Fly   121 AEDANKLADSLELTNTRVKIWFQNRRARERREKREKDESCDST-FSSNASSPEP 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 22/51 (43%)
CG15696NP_650921.1 Homeobox 97..144 CDD:278475 19/67 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I3229
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.