DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and Nanog

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001094251.1 Gene:Nanog / 414065 RGDID:1303178 Length:312 Species:Rattus norvegicus


Alignment Length:330 Identity:81/330 - (24%)
Similarity:111/330 - (33%) Gaps:123/330 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 HSTPRSNHHSRHGTS-----------HYNGDQIS--QQLGSGAAQHPPVPTTQPQPPPPPPLNGG 195
            ||.|.....|..|.|           :|:..|:|  :.|.:..|..||.....|....|      
  Rat     9 HSLPSCEEASNSGDSSPMPAVHLPEENYSCLQVSATEMLCTETASPPPSSGDLPLQDSP------ 67

  Fly   196 SGASNGVLYPNAPYTDHGFLQMTLGYLSPSSGTYKSVDPYFLSQASLFGGAPFFGAPGCVPELAL 260
            ..:||..|..:.|..|.|          |.    |..:...|:                      
  Rat    68 DSSSNPKLKLSGPEADEG----------PE----KKEENKVLT---------------------- 96

  Fly   261 GLGMGVNALRHCRRRKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNR 325
                        :::|.|||||..||..|:.||:.|||||..:..:|:|.|.||..||||||||:
  Rat    97 ------------KKQKMRTVFSQAQLCALKDRFQRQRYLSLQQMQDLSTILNLSYKQVKTWFQNQ 149

  Fly   326 RMK----HKKQLRRRDN-----ANEPVDFSRSEPGKQPGEATSSSGD--------------SKHG 367
            |||    .|.|..:..|     .:.||::.........|...::||:              :...
  Rat   150 RMKCKRWQKNQWLKTSNGLTQKGSAPVEYPSIHCSYSQGYLMNASGNLPVWGSQTWTNPTWNNQT 214

  Fly   368 KLNPGSVGGTPTQPT-----------------------------SEQQLQMCL-MQQGYSTDDYS 402
            ..||.....|.|.||                             .|..||..: :||.:|.   |
  Rat   215 WTNPTWSNQTWTNPTWSNQAWSTQSWCTQAWNSQTWNAAPLHNFGEDSLQPYVPLQQNFSA---S 276

  Fly   403 DLEAD 407
            ||||:
  Rat   277 DLEAN 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 31/55 (56%)
NanogNP_001094251.1 Homeobox 102..154 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24327
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.