DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and ventx1.2

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_988861.1 Gene:ventx1.2 / 394455 XenbaseID:XB-GENE-920868 Length:262 Species:Xenopus tropicalis


Alignment Length:118 Identity:47/118 - (39%)
Similarity:63/118 - (53%) Gaps:17/118 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 RRKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRDN 338
            :|:.||.|:..|::.||:.|..||||...||.:|||:|.|||.||||||||||||.|:|::.:..
 Frog   127 QRRLRTAFTPQQITRLEQAFNKQRYLGASERKKLATSLQLSEIQVKTWFQNRRMKLKRQIQDQQP 191

  Fly   339 A--NEPVDFSRS---EPGKQPGEATSSSGDSKHGKLNPGSVGGTPTQPTSEQQ 386
            :  ..||.:.::   .||..|            ..||.||....|..|....|
 Frog   192 SMVPPPVCYPQTFSYYPGGLP------------VPLNSGSFYQPPAHPFQAPQ 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 32/51 (63%)
ventx1.2NP_988861.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..129 0/1 (0%)
Homeobox 131..183 CDD:278475 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.