DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and BSX

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001091639.1 Gene:BSX / 390259 HGNCID:20450 Length:233 Species:Homo sapiens


Alignment Length:256 Identity:100/256 - (39%)
Similarity:121/256 - (47%) Gaps:80/256 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 HPPVPTTQPQPPPPPPLNGGSGASNGVLYPNAPYTDHGF-LQMTLGYLSPSS------GTYKSVD 233
            |.|.|..:..|        ...||:  |....|..|:|: |..|...|:|.:      |.:.  .
Human    28 HKPKPLREVAP--------DHFASS--LASRVPLLDYGYPLMPTPTLLAPHAHHPLHKGDHH--H 80

  Fly   234 PYFLSQASLFGGAPFFGAPGCVPELALGLGMGVNAL-----------RHCRRRKARTVFSDPQLS 287
            ||||:.:                      ||.|.||           :|||||||||||||.|||
Human    81 PYFLTTS----------------------GMPVPALFPHPQHAELPGKHCRRRKARTVFSDSQLS 123

  Fly   288 GLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRDNANEPVDFSRSEPGK 352
            |||||||.||||||||||||||||.||||||||||||||||||||||:          |:.||..
Human   124 GLEKRFEIQRYLSTPERVELATALSLSETQVKTWFQNRRMKHKKQLRK----------SQDEPKA 178

  Fly   353 QPGEATSSSGDSKHGKLNPGSVGGTP--TQPTSEQQLQMCLMQQGYSTDDYSDLEADSGDE 411
            ..|               |.|..|:|  ::..:..:.::.|....:...:..| |.|.|||
Human   179 PDG---------------PESPEGSPRGSEAATAAEARLSLPAGPFVLTEPED-EVDIGDE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 48/51 (94%)
BSXNP_001091639.1 Homeobox 114..166 CDD:278475 48/51 (94%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..233 26/90 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6460
eggNOG 1 0.900 - - E1_KOG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006209
OrthoInspector 1 1.000 - - oto90467
orthoMCL 1 0.900 - - OOG6_109885
Panther 1 1.100 - - O PTHR24327
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3788
SonicParanoid 1 1.000 - - X4485
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.