DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and NANOGP8

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001342210.1 Gene:NANOGP8 / 388112 HGNCID:23106 Length:305 Species:Homo sapiens


Alignment Length:59 Identity:32/59 - (54%)
Similarity:41/59 - (69%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 RRRKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKK 331
            :::|.|||||..||..|..||:.|:|||..:..||:..|.||..||||||||:|||.|:
Human    94 KKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 30/51 (59%)
NANOGP8NP_001342210.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96 0/1 (0%)
HOX 95..151 CDD:197696 31/55 (56%)
8 X repeats starting with a Trp in each unit 196..240
Sufficient for transactivation activity. /evidence=ECO:0000250 196..240
Sufficient for strong transactivation activity. /evidence=ECO:0000250 241..305
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.