DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and Dll

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster


Alignment Length:271 Identity:77/271 - (28%)
Similarity:114/271 - (42%) Gaps:78/271 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 PPPPPPLNGGSGASN---GVLYP-NAPYTD--------HGFLQMTLGYLSPSSGTYKSVDPYFLS 238
            |..|..::||:.|::   |:..| .:.:.:        :|.::.|..:..|..|.    |..|.|
  Fly     7 PHTPKYMDGGNTAASVTPGINIPGKSAFVELQQHAAAGYGGIRSTYQHFGPQGGQ----DSGFPS 67

  Fly   239 QASLFGGAPF------------FG--APGC---------VPELALGLGMGVNALRHCRRRKARTV 280
            ..|.. |.||            .|  ||.|         :.:.....|:.||. :..:.||.||:
  Fly    68 PRSAL-GYPFPPMHQNSYSGYHLGSYAPPCASPPKDDFSISDKCEDSGLRVNG-KGKKMRKPRTI 130

  Fly   281 FSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRD----NANE 341
            :|..||..|.:||:..:||:.|||.|||.:|||::||||.||||||.|:||.::...    |:..
  Fly   131 YSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKMMKAAQGPGTNSGM 195

  Fly   342 PVDFSRSEPGK------QPGEATS------------------SSGDSKHGKLNPGS------VGG 376
            |:......||:      ..||..:                  |:|.:..|..|.||      .|.
  Fly   196 PLGGGGPNPGQHSPNQMHSGELANGRFLWAALETNGTLALVHSTGGNNGGGSNSGSPSHYLPPGH 260

  Fly   377 TPT---QPTSE 384
            :||   .|.||
  Fly   261 SPTPSSTPVSE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 30/51 (59%)
DllNP_001137759.1 Homeobox 127..180 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458097
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574097at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.