DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and ap

DIOPT Version :10

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_724428.1 Gene:ap / 35509 FlyBaseID:FBgn0267978 Length:469 Species:Drosophila melanogaster


Alignment Length:201 Identity:38/201 - (18%)
Similarity:67/201 - (33%) Gaps:51/201 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 SGASNGVLYP-----NAPYTDHGFLQMTLGYLSPSSGTYKSVDP--YFLSQASLFGGAP------ 247
            :.:|....||     .:|:.|..         ||.|...:|:.|  .|:..:.:..|.|      
  Fly   273 ASSSMSATYPYSAQFGSPHNDSS---------SPHSDPSRSIVPTGIFVPASHVINGLPQPARQK 328

  Fly   248 ------------FFGAPGCVPELALGLGMGVNALRHCRRRKARTVFSDPQLSGLEKRFEGQRYLS 300
                        .|.|...:....:..|.|.:.....|.::.||.|...||..::..|.......
  Fly   329 GRPRKRKPKDIEAFTANIDLNTEYVDFGRGSHLSSSSRTKRMRTSFKHHQLRTMKSYFAINHNPD 393

  Fly   301 TPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRD-----------------NANEPVDFSRS 348
            ..:..:|:...||.:..::.||||.|.|.::.:.::|                 :.:.|..|...
  Fly   394 AKDLKQLSQKTGLPKRVLQVWFQNARAKWRRMMMKQDGSGLLEKGEGALDLDSISVHSPTSFILG 458

  Fly   349 EPGKQP 354
            .|...|
  Fly   459 GPNSTP 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeodomain 275..331 CDD:459649 15/55 (27%)
apNP_724428.1 LIM1_Lhx2_Lhx9 148..201 CDD:188755
LIM2_Lhx2_Lhx9 206..264 CDD:188763
Homeodomain 368..424 CDD:459649 15/55 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.