DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and tup

DIOPT Version :10

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_476775.1 Gene:tup / 35147 FlyBaseID:FBgn0003896 Length:534 Species:Drosophila melanogaster


Alignment Length:183 Identity:49/183 - (26%)
Similarity:67/183 - (36%) Gaps:38/183 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 DTNGIAANTNNYAPKSSRNAVKSARSAFAHDNN--------PHKHPSQHSHPPQSHPPASASASA 121
            |:|| |.||:..|.:...|.:      ..:|.|        ||.||:|  .||..|||.......
  Fly   365 DSNG-AINTHTPAFQQLVNQM------HGYDLNGMPILPPHPHSHPAQ--GPPHQHPPPPGGPHN 420

  Fly   122 TATARSNQAASGYAGEDYGKSMHSTPRSNHHSRHGTSHY-----NGDQISQQLGSGAAQHPPVPT 181
            ....:.||       :..|.|:.|...|:||. ..|..|     :.|:....|...::......|
  Fly   421 HQNQQPNQ-------QPGGSSLDSGITSHHHP-DSTDSYVTYLESDDKSKLALTPSSSSSASAGT 477

  Fly   182 TQPQPPPPPPLNGGS--GASNGVL----YPNAPYTDH--GFLQMTLGYLSPSS 226
            :...||......||.  |..:|||    ..|...|:.  ..||...|..||:|
  Fly   478 SISSPPSGVGAGGGGAVGGGSGVLGLGVVANQSATEQLMQMLQKVTGSASPAS 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeodomain 275..331 CDD:459649
tupNP_476775.1 LIM1_Isl 54..108 CDD:188752
LIM2_Isl 116..171 CDD:188760
HOX 241..297 CDD:197696
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.