DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and Pph13

DIOPT Version :10

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster


Alignment Length:60 Identity:26/60 - (43%)
Similarity:37/60 - (61%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 RRRKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQ 332
            ::|:.||.|:..||..||:.|:...|.....|.|||..:.|:|.:|:.||||||.|.:||
  Fly     9 KQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQ 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeodomain 275..331 CDD:459649 24/55 (44%)
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 24/55 (44%)

Return to query results.
Submit another query.