DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and HOXC8

DIOPT Version :10

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_073149.1 Gene:HOXC8 / 3224 HGNCID:5129 Length:242 Species:Homo sapiens


Alignment Length:43 Identity:14/43 - (32%)
Similarity:18/43 - (41%) Gaps:16/43 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GALAAL-----LLIS-----VVSSIFSL------IVVPLWLAW 130
            |..|||     ||:|     |.|.|.|.      :::|..|.|
Human   128 GVSAALNLKGPLLVSTESHLVKSGIHSQYCWLCPVLLPQALGW 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeodomain 275..331 CDD:459649
HOXC8NP_073149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..154 10/25 (40%)
Antp-type hexapeptide 138..143 2/4 (50%)
Homeodomain 150..206 CDD:459649 6/21 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..242
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.