DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and HOXC6

DIOPT Version :10

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_004494.1 Gene:HOXC6 / 3223 HGNCID:5128 Length:235 Species:Homo sapiens


Alignment Length:72 Identity:34/72 - (47%)
Similarity:45/72 - (62%) Gaps:6/72 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 GLGMGVNALRHCRRRKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNR 325
            |:|.|.:      ||:.|.::|..|...|||.|...|||:...|:|:|.||.|:|.|:|.|||||
Human   134 GVGYGAD------RRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNR 192

  Fly   326 RMKHKKQ 332
            |||.||:
Human   193 RMKWKKE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeodomain 275..331 CDD:459649 28/55 (51%)
HOXC6NP_004494.1 Antp-type hexapeptide 122..127
Homeodomain 142..198 CDD:459649 28/55 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..235 34/72 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.