DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and vnd

DIOPT Version :10

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster


Alignment Length:123 Identity:26/123 - (21%)
Similarity:50/123 - (40%) Gaps:31/123 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LYSAAVHKLVVLMNAGVFGFLQLSDLSAIGTNAVVSTSVMFETHRATFLCYWVLILIYAFLRIYE 84
            |:|.||.:.:|:.|.....:.:||       |:..:..|:|...        ::.:|::.....|
  Fly   132 LFSVAVIRTLVIRNPMSPKYAKLS-------NSSTALRVIFGVS--------IICIIFSINTALE 181

  Fly    85 IKLRIVSFR---------MLVGH-ISHLFGALAALLL------ISVVSSIFSLIVVPL 126
            .::.|:..:         :..|| :|.||......||      .::||.|...|:.|:
  Fly   182 NEIEIIDRKPSECNSKGVISYGHVVSKLFWQNDEFLLKISTFTTAIVSHIIPCILFPI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeodomain 275..331 CDD:459649
vndNP_476786.2 Homeodomain 546..602 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.