DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and dlx4b

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_571393.1 Gene:dlx4b / 30581 ZFINID:ZDB-GENE-990415-50 Length:254 Species:Danio rerio


Alignment Length:283 Identity:78/283 - (27%)
Similarity:109/283 - (38%) Gaps:82/283 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 AFAHDNNPHKHPSQHSHPPQSHPPASASASATATARSNQAASGYAGEDYG-KSMHSTPRSNHHSR 154
            :|..|......||:.:.....|..||          :.|..||:|...|. ..:||.....|.:.
Zfish     5 SFMSDTLNSSDPSKSAFLEFGHGLAS----------NQQHLSGFAHNIYPVHGLHSGGHLQHDAP 59

  Fly   155 HGTS--HYNGDQISQQLGSGAAQHPPVPTTQPQPPPPPPLNGGSGASNGVLYPNAPYTDHGFLQM 217
            :.:|  ||     |:.||...               |.|:   |.|:.|...|..|....|.|..
Zfish    60 YPSSAPHY-----SRPLGYAY---------------PGPV---SAAAPGAYMPYQPNNHSGALAH 101

  Fly   218 TLGYLSPSSGTYKSVDPYFLSQASLFGGAPFFGAPGCVPELAL-GLGMGVNALRHCRRRKARTVF 281
            |           ::.|......|.:..|           |:.| |.|..:        ||.||::
Zfish   102 T-----------RAEDTNHEKPAVIENG-----------EIRLNGKGKKI--------RKPRTIY 136

  Fly   282 SDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRDNANEPVDFS 346
            |..||..|.:||:..:||:.|||.:||..|||::||||.||||:|.|:||.::...:..|     
Zfish   137 SSVQLQALHQRFQQTQYLALPERADLAAKLGLTQTQVKIWFQNKRSKYKKIMKHGSSGPE----- 196

  Fly   347 RSEPGKQPGEA--TSSSGDSKHG 367
                    ||.  ||||.....|
Zfish   197 --------GELLHTSSSSPCSPG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 28/51 (55%)
dlx4bNP_571393.1 Homeobox 132..185 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574097at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.