DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and dlx5a

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_571381.2 Gene:dlx5a / 30569 ZFINID:ZDB-GENE-990415-49 Length:282 Species:Danio rerio


Alignment Length:319 Identity:92/319 - (28%)
Similarity:125/319 - (39%) Gaps:107/319 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 NPHKHPSQHSHPPQSHPPASASASATATARSNQAASGYAGEDYGKSMHSTPRSNHHSRHGTSHYN 161
            ||.:..:.| ||.|..|....|   |||      .|||          .:|....|  ||....|
Zfish    19 NPFQLSTMH-HPSQESPTLPES---TAT------DSGY----------YSPAGGVH--HGYCSPN 61

  Fly   162 GDQISQQLGSGAAQHPPVPTTQPQPPPPPPLNGGSGASNGVLYPNAPYTDHGFLQMTLGYLSPSS 226
            .....:.|.:...|:..|             ||.||..:...||     |:|  ..:..| ...:
Zfish    62 SGTYGKPLNAYQYQYHGV-------------NGSSGNYSAKSYP-----DYG--SYSTAY-HQYA 105

  Fly   227 GTYKSVDPYFLSQASLFGGAPFFGAP----GCVPELALGLGMGVNALRHCRRRKARTVFSDPQLS 287
            |||..|.    ||.|          |    ...||:.:     ||. :..:.||.||::|..||:
Zfish   106 GTYNRVQ----SQPS----------PQEKETAEPEVRM-----VNG-KPKKVRKPRTIYSSFQLA 150

  Fly   288 GLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRDNANEPVDFSRS---- 348
            .|::||:..:||:.|||.|||.:|||::||||.||||:|.|.||.::   |...|.:.|.|    
Zfish   151 ALQRRFQNTQYLALPERAELAASLGLTQTQVKIWFQNKRSKLKKIMK---NGELPPEHSPSSSDP 212

  Fly   349 ------------------EPGKQPG----------EATSSSGDSKHGKLN-----PGSV 374
                              .|..||.          |:.|||..|..|.:|     ||::
Zfish   213 MACNSPQSPAVWDSQGPQRPHHQPQNINTAASTFLESASSSWYSSTGAMNSHLQAPGTL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 29/51 (57%)
dlx5aNP_571381.2 DLL_N 31..118 CDD:289198 33/142 (23%)
Homeobox 140..193 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574097at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.