DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and en2b

DIOPT Version :10

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_571115.1 Gene:en2b / 30238 ZFINID:ZDB-GENE-980526-40 Length:261 Species:Danio rerio


Alignment Length:57 Identity:27/57 - (47%)
Similarity:37/57 - (64%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 RKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKK 331
            ::.||.|:..||..|:..|:..|||:...|..||..|||:|:|:|.||||:|.|.||
Zfish   173 KRPRTAFTAEQLQRLKNEFQNNRYLTEQRRQALAQELGLNESQIKIWFQNKRAKIKK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeodomain 275..331 CDD:459649 25/55 (45%)
en2bNP_571115.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..125
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..176 0/2 (0%)
Homeodomain 173..229 CDD:459649 25/55 (45%)
Engrail_1_C_sig 230..260 CDD:431338 27/57 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.