Sequence 1: | NP_477350.2 | Gene: | bsh / 35266 | FlyBaseID: | FBgn0000529 | Length: | 429 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055283.1 | Gene: | VENTX / 27287 | HGNCID: | 13639 | Length: | 258 | Species: | Homo sapiens |
Alignment Length: | 204 | Identity: | 62/204 - (30%) |
---|---|---|---|
Similarity: | 83/204 - (40%) | Gaps: | 53/204 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 163 DQISQQLGSGAAQHPPVPTTQPQPPPPPPLNGGSGASNGVLYPNAPYTDHGFLQMTLGYL---SP 224
Fly 225 SSGTYKSVDPYFLSQASLFGGAPFFGAPGCVPELAL-GLGMGVNALRHCRRRKARTVFSDPQLSG 288
Fly 289 LEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRDNANEPVDFSRSEPGKQ 353
Fly 354 PGEATSSSG 362 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bsh | NP_477350.2 | Homeobox | 278..330 | CDD:278475 | 28/51 (55%) |
VENTX | NP_055283.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..93 | 23/113 (20%) | |
Homeobox | 95..147 | CDD:306543 | 28/51 (55%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 227..248 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR24327 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |