DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and VENTX

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_055283.1 Gene:VENTX / 27287 HGNCID:13639 Length:258 Species:Homo sapiens


Alignment Length:204 Identity:62/204 - (30%)
Similarity:83/204 - (40%) Gaps:53/204 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 DQISQQLGSGAAQHPPVPTTQPQPPPPPPLNGGSGASNGVLYPNAPYTDHGFLQMTLGYL---SP 224
            |.:||...||       ||..|:|                            ...:||.|   ..
Human    21 DWLSQSSCSG-------PTHTPRP----------------------------ADFSLGSLPGPGQ 50

  Fly   225 SSGTYKSVDPYFLSQASLFGGAPFFGAPGCVPELAL-GLGMGVNALRHCRRRKARTVFSDPQLSG 288
            :||..:......:.:|:.....|       .||..: ||....|.||..|   .||.|:..|:..
Human    51 TSGAREPPQAVSIKEAAGSSNLP-------APERTMAGLSKEPNTLRAPR---VRTAFTMEQVRT 105

  Fly   289 LEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRDNANEPVDFSRSEPGKQ 353
            ||..|:..:|||..||..||..:.|||.|:||||||||||||:|: :....:.|...|...|   
Human   106 LEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMKHKRQM-QDPQLHSPFSGSLHAP--- 166

  Fly   354 PGEATSSSG 362
            |...::|||
Human   167 PAFYSTSSG 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 28/51 (55%)
VENTXNP_055283.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..93 23/113 (20%)
Homeobox 95..147 CDD:306543 28/51 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..248
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.