DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and Obox6

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_663756.2 Gene:Obox6 / 252830 MGIID:2149036 Length:347 Species:Mus musculus


Alignment Length:269 Identity:65/269 - (24%)
Similarity:112/269 - (41%) Gaps:19/269 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 YGKSMHSTPRSNHHSRHGTSHYNGDQISQQLGSGAAQHPPVPTTQ-PQPPPPPPLNGGSGASNGV 202
            |.:|.|.....:.||:...|.....:||.|:....|::.|....| |...|..|:..........
Mouse     4 YNQSPHMPQDPSLHSKFQMSSSAPIEISFQMHQEPARNLPFQMCQSPLVIPRSPMQSSHSVPERD 68

  Fly   203 LYPNAPYTDHG--FLQMTLG-YLSPSSGTYKSV---DPYFL-SQASLFGGAPFFGAPGCVPELAL 260
            |.|.......|  .:||..| .:.|:....:|:   .|:.: |::|:..|  |.|:.|.:.....
Mouse    69 LCPQESQGPSGKSSIQMQPGLVMDPALPILRSLLMHSPHQIPSRSSVRAG--FQGSLGPMVRSPS 131

  Fly   261 GLGMGVNALRHCRRRKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNR 325
            .....|:.:...:.||.|||:::.|...|:|.|....|.|..:|:.||..:|::..:::.||:|.
Mouse   132 YGDRRVSLVTPRKHRKIRTVYTEEQKCVLKKHFHKCTYPSREQRMALAVLVGVTANEIQIWFKNH 196

  Fly   326 RMKHKKQ--------LRRRDNANEPVDFSRSEPGKQPGEATSSSGDSKHGKLNPGSVGGTP-TQP 381
            |.|.|::        |...:.::|.|..|...|...|..|:::......|.....|:.... :|.
Mouse   197 RAKSKRESLQNVPAALPETNGSSEAVSESVHFPDSLPVVASANGESMWSGTFGEDSIPNLNWSQE 261

  Fly   382 TSEQQLQMC 390
            :|....|.|
Mouse   262 SSPPHYQAC 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 18/51 (35%)
Obox6NP_663756.2 COG5576 86..>204 CDD:227863 32/119 (27%)
homeodomain 146..204 CDD:238039 21/57 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.