DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and Nkx1-2

DIOPT Version :10

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_033149.1 Gene:Nkx1-2 / 20231 MGIID:104806 Length:305 Species:Mus musculus


Alignment Length:110 Identity:48/110 - (43%)
Similarity:57/110 - (51%) Gaps:4/110 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 RKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRDNA 339
            |:|||.|:..||..||.:|...||||..||:.||.:|.|:|||||.||||||.|.|||....|.|
Mouse   157 RRARTAFTYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGADGA 221

  Fly   340 NEPVDFSRSEPGKQPGEATSSSGDSKHGKLNPGSVGGTPTQ--PT 382
            .: ......:|| .||......|.:......|...|..|.|  ||
Mouse   222 VQ-AGGGAPQPG-TPGAVAGGGGSATGSSPGPPVPGALPYQTFPT 264

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeodomain 275..331 CDD:459649 32/55 (58%)