DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and Obox7

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001033765.1 Gene:Obox7 / 194588 MGIID:3646231 Length:218 Species:Mus musculus


Alignment Length:209 Identity:52/209 - (24%)
Similarity:81/209 - (38%) Gaps:45/209 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 QISQQLGSGAAQHPPVPTTQPQPPPPPPLNGGSGASNGVLYPNAPYTDHGFLQMTLGYLSPSSGT 228
            :||.|:....|::.|...:|     .|.:..||...:.:..|     :...||......|..||.
Mouse    20 EISSQIPQELAKNLPFQMSQ-----SPLVTPGSTMQSSLSVP-----ERNLLQQESEGPSRQSGC 74

  Fly   229 YKSVDPYFLSQASLFGGAPFFGAPGCVPELALGLGMGVNALRHCRRRKARTVFSDPQLSGLEKRF 293
            ....|.|...|..|.....|                          ||.|.|:|..|...|:|.|
Mouse    75 MPLSDKYVNKQTGLLASRNF--------------------------RKERIVYSKEQQRLLQKHF 113

  Fly   294 EGQRYLSTPERVELATALGLSETQVKTWFQNRRMKH--------KKQLRRRDNANEPVDFSRSEP 350
            :..:|....:.||||..:|:::.::|.||:|.|.|:        |:.|...:.:::.|..|...|
Mouse   114 DECQYPKEKKIVELAVLIGVTKMEIKKWFKNNRAKYRQMNLQNIKQALPESNGSSKAVSESTHFP 178

  Fly   351 GKQPGEATSSSGDS 364
            |..|..| |.:|:|
Mouse   179 GSIPVVA-SDNGES 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 19/59 (32%)
Obox7NP_001033765.1 homeodomain 95..153 CDD:238039 21/57 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.