DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and ceh-27

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001256348.1 Gene:ceh-27 / 185853 WormBaseID:WBGene00000449 Length:263 Species:Caenorhabditis elegans


Alignment Length:234 Identity:69/234 - (29%)
Similarity:102/234 - (43%) Gaps:35/234 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 SGASN-GVLYPNA--PYTDHGFLQMTLGYLSPSSGTYKSVDPYF------------LSQASLFGG 245
            ||:|| ....||:  |.|| .|  .||...:|:  |..:...||            .:.::.:..
 Worm     3 SGSSNSSTSAPNSVTPTTD-AF--STLSISAPA--TTAAQMSYFAFPNQYPHDFSSYNTSAAYAT 62

  Fly   246 APFFGAPGCVPELA---------LGLGMGVNALRHCRRRKARTVFSDPQLSGLEKRFEGQRYLST 301
            ||:..|..  |:||         |.||:.........|||.|.:||..|:..||::|:..||||.
 Worm    63 APYPMATH--PQLANFNRFQTNQLNLGLTTQQNMMISRRKRRVLFSPQQVHVLERKFQINRYLSA 125

  Fly   302 PERVELATALGLSETQVKTWFQNRRMKHKKQLR-RRDNANEPVDFSRSEPGKQPGEATSSSGDSK 365
            .:|..||.::.||.||||.||||:|.|.|:|.: ::.:.....|..|.....:..:::.|.|.|.
 Worm   126 ADRENLAKSINLSATQVKIWFQNQRYKCKRQEKEKKMDGGCYRDSDRDTDSDRDNDSSGSLGSSM 190

  Fly   366 HGKLNPGSVGGTPTQPTSEQQLQMCL---MQQGYSTDDY 401
            .|..........|..|::......||   .||.:....|
 Worm   191 SGIKKEEDEDRKPFMPSAVSSDTACLPDISQQAFPYQMY 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 26/51 (51%)
ceh-27NP_001256348.1 homeodomain 99..157 CDD:238039 29/57 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I3864
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.