DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and tab-1

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_495392.1 Gene:tab-1 / 185156 WormBaseID:WBGene00006380 Length:197 Species:Caenorhabditis elegans


Alignment Length:220 Identity:81/220 - (36%)
Similarity:99/220 - (45%) Gaps:68/220 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 TARSNQAASGYAGEDYGKSMHSTPRSNHHSRHGTSHYNGDQISQQLGSGAAQHPPVPTTQPQPPP 188
            |:.:.|::|....|....|:.|.|.:|..:...|     ..:|.||...||..|           
 Worm    30 TSPTPQSSSDEGSEKSSISVMSVPLTNELTPTIT-----PALSDQLWLAAAAFP----------- 78

  Fly   189 PPPLNGGSGASNGVLYPNAPYTDHGFLQMTLGYLSPSSGTYKSVDPYFLSQASLFGGAPFFGAPG 253
                                 .:|..|      |:..:|.:    |.|.|.|.            
 Worm    79 ---------------------IEHSLL------LAQRNGVF----PGFWSTAD------------ 100

  Fly   254 CVPELALGLGMGVNALR----HCRRRKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLS 314
                 .:.|.....|.|    .|.||||||||||.||.|||:|||.|||||||||:|||.||.||
 Worm   101 -----QIRLSNATKAYRRLRLECSRRKARTVFSDQQLQGLERRFESQRYLSTPERIELANALNLS 160

  Fly   315 ETQVKTWFQNRRMKHKKQLRRRDNA 339
            |||||||||||||||||.:|:.||:
 Worm   161 ETQVKTWFQNRRMKHKKVVRKDDNS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 44/51 (86%)
tab-1NP_495392.1 Homeobox 124..177 CDD:365835 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159037
Domainoid 1 1.000 104 1.000 Domainoid score I4203
eggNOG 1 0.900 - - E1_KOG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006209
OrthoInspector 1 1.000 - - oto19060
orthoMCL 1 0.900 - - OOG6_109885
Panther 1 1.100 - - LDO PTHR24327
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3788
SonicParanoid 1 1.000 - - X4485
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.