DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and Nkx2-6

DIOPT Version :10

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_035050.2 Gene:Nkx2-6 / 18092 MGIID:97351 Length:289 Species:Mus musculus


Alignment Length:238 Identity:70/238 - (29%)
Similarity:88/238 - (36%) Gaps:98/238 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 QLGSGAAQHPPVPTTQPQPPPPPPLNGGS----GASNGVLYPNAPYTDHGFLQMTLGYLSPSSGT 228
            ::||.       |..:||.||      |:    ||.|       |.||.|     :|.||     
Mouse    73 EMGSN-------PVGEPQTPP------GTISRLGARN-------PMTDRG-----VGNLS----- 107

  Fly   229 YKSVDPYFLSQASLFGGAPFFGAPGCVPELALGLGMGVNALRHCRRRKARTVFSDPQLSGLEKRF 293
                       ..:..|.|.                   :.|...:||:|.:||..|:..||:||
Mouse   108 -----------GDMRRGGPV-------------------STRTRPQRKSRVLFSQAQVLALERRF 142

  Fly   294 EGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRDNANE-------------PVDF 345
            :.||||:.|||..||:||.|:.||||.||||||.|.|.|  |:|...|             ||..
Mouse   143 KQQRYLTAPEREHLASALQLTSTQVKIWFQNRRYKSKSQ--RQDQTLELAGHPLAPRRVAVPVLV 205

  Fly   346 SRSEPGKQPGEATSSSGDSKHGKLNP----------GSVGGTP 378
            ...:|...|..|..         |.|          |...|||
Mouse   206 LDGKPCLDPDVAAF---------LGPYKATSPYSCFGGYAGTP 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeodomain 275..331 CDD:459649 33/55 (60%)
Nkx2-6NP_035050.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..125 21/109 (19%)
Homeodomain 124..179 CDD:459649 33/54 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..289
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.