DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and ceh-24

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_506419.3 Gene:ceh-24 / 179877 WormBaseID:WBGene00000447 Length:299 Species:Caenorhabditis elegans


Alignment Length:236 Identity:65/236 - (27%)
Similarity:91/236 - (38%) Gaps:40/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 QISQQLGSGAAQHPPVPTTQPQPPPPPPLNGGSGASNGVLYPNAPYTDHGFLQMTLGYLSPSSGT 228
            ::.|||...||.....|.|....|...|...|....|   |...|:.         ||.......
 Worm    60 RVQQQLLKMAASKSGTPGTNAGVPGAFPYGPGRLPGN---YFAGPFP---------GYSGAQPNW 112

  Fly   229 YKSVDPYFLSQASLFGGAPFFGAPGCVPELALGLGMGVNALRHCRRRKARTVFSDPQLSGLEKRF 293
            |...||.|.:.|:|.        |..:..:...:....:.....:|||.|.:||..|:..||:||
 Worm   113 YNGNDPRFAAAAALL--------PCSIDPVRSAINHQFSMSSMSQRRKRRVLFSQAQVYELERRF 169

  Fly   294 EGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRDNANEPVDFSRSEPGKQPGEAT 358
            :..:||:.|||.:||.::.|:.||||.||||.|.|.|:|.:.:..:.    ...||.|..|....
 Worm   170 KQAKYLTAPEREQLANSIRLTPTQVKIWFQNHRYKCKRQEKEKAMSG----LGHSEDGSSPPPDN 230

  Fly   359 SSSGD----------------SKHGKLNPGSVGGTPTQPTS 383
            ....|                |:...|.|..|.|.|..|.:
 Worm   231 DDDDDKYSIEMDDKDDEEEEESEKPVLKPSGVFGLPYPPNA 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 26/51 (51%)
ceh-24NP_506419.3 Homeobox 153..206 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I3864
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.