DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and ceh-43

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001338832.1 Gene:ceh-43 / 175581 WormBaseID:WBGene00000463 Length:282 Species:Caenorhabditis elegans


Alignment Length:243 Identity:71/243 - (29%)
Similarity:103/243 - (42%) Gaps:54/243 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 PPLNGGSGASNGVLYPNAPYTDHGFLQMTLGYLSPSSGTYKSVDPYFLSQASLFGG-------AP 247
            ||.:.|:|::   :.|..||  |.:         |:|.|..:      :..|::|.       |.
 Worm    22 PPTSNGAGSN---VSPYFPY--HAY---------PTSSTNGA------TGGSMYGTPQQTSAYAM 66

  Fly   248 FFGAPGCVPELALGLGMGVNALRHC---------RRRKARTVFSDPQLSGLEKRFEGQRYLSTPE 303
            :...||..||.|.........:..|         :.||.||:::..||..|:|:|:..:||:.|:
 Worm    67 YPPGPGSSPEEAFPEHTTTKIVEGCEAKYNVKGKKMRKPRTIYNSSQLQMLQKKFQKTQYLALPD 131

  Fly   304 RVELATALGLSET---------QVKTWFQNRRMKHKKQL-RRRDNAN--EPVDFSRSEPGKQP-G 355
            |..||..||||:|         |||.||||||.|.|||. ...|:|:  |..|...|:|...| |
 Worm   132 RAALAHELGLSQTQRAQPITEFQVKIWFQNRRSKQKKQKGGSSDHASDEEDDDTEESKPESPPMG 196

  Fly   356 EATSSSGDSKHGKLNPGSVGGT-----PTQPTSEQQLQMCLMQQGYST 398
            |:......|:...|...|:...     |....:||.....|....:||
 Worm   197 ESVMIQESSEPRTLVSSSIKTEMKEEYPPMTLNEQYASPYLYGSDFST 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 28/60 (47%)
ceh-43NP_001338832.1 Homeobox 105..168 CDD:365835 28/62 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574097at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.