DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and DLX5

DIOPT Version :10

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_005212.1 Gene:DLX5 / 1749 HGNCID:2918 Length:289 Species:Homo sapiens


Alignment Length:273 Identity:76/273 - (27%)
Similarity:110/273 - (40%) Gaps:107/273 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 SGAAQHPPVPTTQPQPPPPPPLNGGSGASNGVLYP---NAPYTDHGFLQMTLGYLSPSSGTY-KS 231
            :.||.|.|   :|..|..|.     |.|::...|.   .||:          ||.||:|.:| |:
Human    23 TSAAMHHP---SQESPTLPE-----SSATDSDYYSPTGGAPH----------GYCSPTSASYGKA 69

  Fly   232 VDPY-----------------------FLSQASLFGGAPFFGAPGCV---------PELALGLGM 264
            ::||                       :.|....:||| :...|...         ||:.:    
Human    70 LNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGA-YNRVPSATNQPEKEVTEPEVRM---- 129

  Fly   265 GVNALRHCRRRKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKH 329
             ||. :..:.||.||::|..||:.|::||:..:||:.|||.|||.:|||::||||.||||:|.|.
Human   130 -VNG-KPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKI 192

  Fly   330 KKQLRRRDNANEPVDFSRSEPGKQPGEATSSSGD----------------------SKHGKLNPG 372
            ||.::.               |:.|.|.:.||.|                      |.|...:| 
Human   193 KKIMKN---------------GEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHP- 241

  Fly   373 SVGGTPTQPTSEQ 385
                    |||.|
Human   242 --------PTSNQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeodomain 275..331 CDD:459649 31/55 (56%)
DLX5NP_005212.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 9/33 (27%)
DLL_N 32..118 CDD:463567 22/101 (22%)
Homeodomain 138..194 CDD:459649 31/55 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..251 13/73 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..289
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.