DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and DLX3

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_005211.1 Gene:DLX3 / 1747 HGNCID:2916 Length:287 Species:Homo sapiens


Alignment Length:261 Identity:70/261 - (26%)
Similarity:102/261 - (39%) Gaps:84/261 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 YAGEDYGKSMHSTPRSNHHSRHGTSHYNGDQISQQLGSGAAQHPPVPTTQPQPPPPPPLNGGSGA 198
            |:|:.||::::  |.:.||      .:|                              |||.:| 
Human    51 YSGQPYGQTVN--PYTYHH------QFN------------------------------LNGLAG- 76

  Fly   199 SNGVLYPNAPYTDHGFLQMTLGYLSPSSGTYK-----SVDPYFLSQASLFGGAPFFGAPGCVPEL 258
             .|...|.:.|        |.|......|.|:     :.||..:.:.               ||.
Human    77 -TGAYSPKSEY--------TYGASYRQYGAYREQPLPAQDPVSVKEE---------------PEA 117

  Fly   259 ALGLGMGVNALRHCRRRKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQ 323
            .:.:..|    :..:.||.||::|..||:.|::||:..:||:.|||.|||..|||::||||.|||
Human   118 EVRMVNG----KPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQ 178

  Fly   324 NRRMKHKKQLRRRDNANEPVDFSRSEPGKQPGEATSSS------GDSKHGKLNPGSVGGTPTQPT 382
            |||.|.||..:   |...|::.|   |......|.:|.      ..|.|....|......|..|.
Human   179 NRRSKFKKLYK---NGEVPLEHS---PNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPY 237

  Fly   383 S 383
            |
Human   238 S 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 30/51 (59%)
DLX3NP_005211.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39
DLL_N 27..107 CDD:403572 19/103 (18%)
COG5576 <109..232 CDD:227863 46/147 (31%)
homeobox 129..188 34/58 (59%)
Homeobox 132..186 CDD:395001 30/53 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..287 10/47 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574097at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.