DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and DLX2

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_004396.1 Gene:DLX2 / 1746 HGNCID:2915 Length:328 Species:Homo sapiens


Alignment Length:292 Identity:80/292 - (27%)
Similarity:111/292 - (38%) Gaps:80/292 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 MHST---PRSNHHSRHGTSHYNGDQISQQLGSGAAQHPPVPTTQPQPPPPPPLN----------- 193
            ||||   ..|.:|.........|........|.::.|      :||..|..|::           
Human    12 MHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLH------KPQESPTLPVSTATDSSYYTNQ 70

  Fly   194 ---GGSGASNGVLYP-------------NAPYTDHGFLQMTLGYLSPSSGTYKSVDPYFLSQASL 242
               .|.|...|..|.             |.||:...  ...|||    :..|.|..||..|    
Human    71 QHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKS--SYDLGY----TAAYTSYAPYGTS---- 125

  Fly   243 FGGAPFFGAP---GCVPELALGLGMGVNALRHCRRRKARTVFSDPQLSGLEKRFEGQRYLSTPER 304
              .:|....|   ...||:.:     ||. :..:.||.||::|..||:.|::||:..:||:.|||
Human   126 --SSPANNEPEKEDLEPEIRI-----VNG-KPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPER 182

  Fly   305 VELATALGLSETQVKTWFQNRRMKHKKQLRRRDNANE------------------PVDFSRSEPG 351
            .|||.:|||::||||.||||||.|.||..:..:..:|                  |..:....|.
Human   183 AELAASLGLTQTQVKIWFQNRRSKFKKMWKSGEIPSEQHPGASASPPCASPPVSAPASWDFGVPQ 247

  Fly   352 KQPGEATSSSGDSKHGKLNPGSVGGTPTQPTS 383
            :..|.....||.|     ..||.|.:|:...|
Human   248 RMAGGGGPGSGGS-----GAGSSGSSPSSAAS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 30/51 (59%)
DLX2NP_004396.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..81 11/70 (16%)
DLL_N 51..132 CDD:289198 19/92 (21%)
Homeobox 155..208 CDD:278475 30/52 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..270 10/63 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574097at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.