DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and Hoxd1

DIOPT Version :10

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_034597.2 Gene:Hoxd1 / 15429 MGIID:96201 Length:328 Species:Mus musculus


Alignment Length:253 Identity:67/253 - (26%)
Similarity:91/253 - (35%) Gaps:96/253 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 LGSGAAQHP---PVPTTQPQPPPPPPLNGGSGASNGVLYPNAP-------------------YTD 211
            ||||.....   |:.|.:|.|.||     ...|.:.|..|.||                   ..:
Mouse    46 LGSGDGAFVSCLPLATARPTPSPP-----AGPAQSPVPQPAAPRYAPCTLEGAYERGAAPASAAE 105

  Fly   212 HGFLQM--------TLGYLSPSSGTYKSVDPYFLSQASLFGGAPF----------FGAPG----C 254
            :|||..        .||..:...|.:    .::.:.|...||..|          ||.||    |
Mouse   106 YGFLGSGPAFDFPGALGRAADEGGAH----VHYATSAVFSGGGSFLLSGQVDFAAFGEPGPFPAC 166

  Fly   255 VPELALG----------------------------------LGMGVNALRHCRRRK--------- 276
            :.|.|.|                                  :.:..||.:..:..:         
Mouse   167 LKEPADGHPGPFQTVSPAPGACPKPASPTSSLPAAHSTFEWMKVKRNAPKKSKLSEYGATSPPSA 231

  Fly   277 ARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLR 334
            .||.||..||:.|||.|...:||:...|:|:|..|.|::||||.||||||||.||:.|
Mouse   232 IRTNFSTKQLTELEKEFHFNKYLTRARRIEIANCLQLNDTQVKIWFQNRRMKQKKRER 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeodomain 275..331 CDD:459649 29/64 (45%)
Hoxd1NP_034597.2 PRK12323 <11..217 CDD:481241 35/179 (20%)
Antp-type hexapeptide 204..209 0/4 (0%)
Homeodomain 233..286 CDD:459649 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..328
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.