DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and Hoxc6

DIOPT Version :10

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_006520531.1 Gene:Hoxc6 / 15425 MGIID:96197 Length:243 Species:Mus musculus


Alignment Length:79 Identity:36/79 - (45%)
Similarity:48/79 - (60%) Gaps:6/79 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 CVPELALGLGMGVNALRHCRRRKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQV 318
            |....:||:|.|.:      ||:.|.::|..|...|||.|...|||:...|:|:|.||.|:|.|:
Mouse   135 CFVPGSLGVGYGAD------RRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQI 193

  Fly   319 KTWFQNRRMKHKKQ 332
            |.||||||||.||:
Mouse   194 KIWFQNRRMKWKKE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeodomain 275..331 CDD:459649 28/55 (51%)
Hoxc6XP_006520531.1 Homeodomain 150..206 CDD:459649 28/55 (51%)

Return to query results.
Submit another query.