DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and Dlx5

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_034186.2 Gene:Dlx5 / 13395 MGIID:101926 Length:289 Species:Mus musculus


Alignment Length:279 Identity:77/279 - (27%)
Similarity:110/279 - (39%) Gaps:94/279 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 DQISQQLGSGAAQHP-PVPTTQPQPPPPPPLNGGSGASNGVLYPNAPYTDHGFLQMTLGYLSPSS 226
            |:....:.||..|.| |.......|....|....|.|::...|..|....|       ||.||:|
Mouse     6 DRRVPSIRSGDFQAPFPTSAAMHHPSQESPTLPESSATDSDYYSPAGAAPH-------GYCSPTS 63

  Fly   227 GTY-KSVDPY-----------------------FLSQASLFGGAPFFGAPGCV---------PEL 258
            .:| |:::||                       :.|....:||| :...|...         ||:
Mouse    64 ASYGKALNPYQYQYHGVNGSAAGYPAKAYADYGYASPYHQYGGA-YNRVPSATSQPEKEVAEPEV 127

  Fly   259 ALGLGMGVNALRHCRRRKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQ 323
            .:     ||. :..:.||.||::|..||:.|::||:..:||:.|||.|||.:|||::||||.|||
Mouse   128 RM-----VNG-KPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQ 186

  Fly   324 NRRMKHKKQLRRRDNANEPVDFSRSEPGKQPGEATSSSGD----------------------SKH 366
            |:|.|.||.::.               |:.|.|.:.||.|                      |.|
Mouse   187 NKRSKIKKIMKN---------------GEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHH 236

  Fly   367 GKLNPGSVGGTPTQPTSEQ 385
            ...:|         |||.|
Mouse   237 PHAHP---------PTSNQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 29/51 (57%)
Dlx5NP_034186.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 10/42 (24%)
DLL_N 32..118 CDD:403572 20/93 (22%)
Homeobox 140..194 CDD:395001 29/53 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..253 13/73 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..289
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574097at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.