DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and Dlx4

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_031893.3 Gene:Dlx4 / 13394 MGIID:94904 Length:240 Species:Mus musculus


Alignment Length:237 Identity:75/237 - (31%)
Similarity:102/237 - (43%) Gaps:68/237 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 TTQPQPPPPPPLNGGSGASNGVLYPN-APYTDHGFLQMTLGY-LSPSSGTYKSVDPYFLSQASLF 243
            |:.|.|.|      ..|||| |::|: ||     .|.:...| |..|.||..|.|   ||.:..:
Mouse     2 TSLPCPLP------DRGASN-VVFPDLAP-----ALSVVAAYPLGLSPGTAASPD---LSYSQSY 51

  Fly   244 GGAPFFGAPG-CVP---------------------------------ELALGLGMGVNALRHCRR 274
            |....:..|| ..|                                 :|||.|..........:.
Mouse    52 GHPRSYSHPGPATPGDSYLPRQQQLVAPSQPFHRPAEHPQELEAESEKLALSLVPSQQQSLTRKL 116

  Fly   275 RKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRDNA 339
            ||.||::|..||..|.:||:..:||:.|||.:||..|||::||||.||||:|.|:||.|::  ::
Mouse   117 RKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQ--SS 179

  Fly   340 NEP-VDFSRSEPGKQP-------------GEATSSSG-DSKH 366
            .|| .|||...|...|             .:...||| |:.|
Mouse   180 GEPEEDFSGRPPSLSPHSPALPFIWGLPKADTLPSSGYDNSH 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 28/51 (55%)
Dlx4NP_031893.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..70 7/28 (25%)
Homeobox 119..172 CDD:278475 28/52 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..194 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574097at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.