Sequence 1: | NP_477350.2 | Gene: | bsh / 35266 | FlyBaseID: | FBgn0000529 | Length: | 429 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_031893.3 | Gene: | Dlx4 / 13394 | MGIID: | 94904 | Length: | 240 | Species: | Mus musculus |
Alignment Length: | 237 | Identity: | 75/237 - (31%) |
---|---|---|---|
Similarity: | 102/237 - (43%) | Gaps: | 68/237 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 181 TTQPQPPPPPPLNGGSGASNGVLYPN-APYTDHGFLQMTLGY-LSPSSGTYKSVDPYFLSQASLF 243
Fly 244 GGAPFFGAPG-CVP---------------------------------ELALGLGMGVNALRHCRR 274
Fly 275 RKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRDNA 339
Fly 340 NEP-VDFSRSEPGKQP-------------GEATSSSG-DSKH 366 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bsh | NP_477350.2 | Homeobox | 278..330 | CDD:278475 | 28/51 (55%) |
Dlx4 | NP_031893.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 44..70 | 7/28 (25%) | |
Homeobox | 119..172 | CDD:278475 | 28/52 (54%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 175..194 | 7/20 (35%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D574097at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |