DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and Dlx1

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_034183.1 Gene:Dlx1 / 13390 MGIID:94901 Length:255 Species:Mus musculus


Alignment Length:287 Identity:80/287 - (27%)
Similarity:115/287 - (40%) Gaps:71/287 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 SMHSTPRSNHHSRHGTSHYNGDQISQQLGSGAAQHPPVPTTQPQPPPPPPLNGGSGA-----SNG 201
            :|.:.|.|.:      |..:|..:..:.|      ||     .|...|.|::.|..:     |.|
Mouse     2 TMTTMPESLN------SPVSGKAVFMEFG------PP-----NQQMSPSPMSHGHYSMHCLHSAG 49

  Fly   202 VLYPNAPYTDHGFLQMTLGYLSPSSGTYKSVDPYFLSQASLFGGAPFFGA----PGCVPELAL-- 260
            ...|:..|:........|||...:|.:..:..||..|..|..|.|....:    ||...|.:.  
Mouse    50 HSQPDGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVV 114

  Fly   261 --------GLGMGVNALRHCRRRKARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQ 317
                    |.|..:        ||.||::|..||..|.:||:..:||:.|||.|||.:|||::||
Mouse   115 EGGEVRFNGKGKKI--------RKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQ 171

  Fly   318 VKTWFQNRRMKHKKQLRRRDNANE---------------PVDFSRSEPGKQPGEATSSSGDSKHG 367
            ||.||||:|.|.||.:::...|.|               ||     .||..|..::.....|..|
Mouse   172 VKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSPPV-----PPGWNPNSSSGKGSGSSAG 231

  Fly   368 KLNPGSVGGTPTQPTSEQQLQMCLMQQ 394
            ...|..   |...|::.|:    .|||
Mouse   232 SYVPSY---TSWYPSAHQE----AMQQ 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 29/51 (57%)
Dlx1NP_034183.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38 11/52 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..118 3/22 (14%)
Homeobox 131..185 CDD:395001 29/53 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..233 7/33 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574097at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.