DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and ventx2.2

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_002937178.3 Gene:ventx2.2 / 100494704 XenbaseID:XB-GENE-920515 Length:333 Species:Xenopus tropicalis


Alignment Length:309 Identity:88/309 - (28%)
Similarity:126/309 - (40%) Gaps:74/309 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 NSSDTNG---IAANTNNYAPKSSRNAVKSARSAFAHDNNPHKHPSQHSHPPQSHP--------PA 115
            |:..|.|   .|.::..:..:|||.:.|...|......:|:..||..|......|        |.
 Frog     2 NTRTTTGKMTKAFSSVEWLAQSSRRSHKEQPSKGDQRYSPYPSPSLPSWNSDVSPSSWNSQLSPV 66

  Fly   116 SASAS-----ATATARSNQAASGYAGEDYG----KSMH--STPRSNH--HSRHGTSHYNGDQISQ 167
            :.||.     .:|...|:..:|.|:.||..    |.::  |||..|.  |....|..|:| .:| 
 Frog    67 AGSAQVSPCPGSAQYSSDSESSLYSNEDEDLFCEKDLNTPSTPGDNGLLHKDTATHDYSG-MVS- 129

  Fly   168 QLGSGAAQHPPVPTTQPQPPPPPPLNGGSGASNGVLYPNAPYTDHGFLQMTLGYLSPSSGTYKSV 232
                       ||...|:     ..:....|.:|  |..:  ||.|:....    |.||.|....
 Frog   130 -----------VPANTPR-----TTSNEDAAKSG--YSTS--TDSGYESEA----SRSSSTAPEG 170

  Fly   233 DPYFLSQASLFGGAPFFGAPGCVPELALGLGMGVNALRHCRRRKARTVFSDPQLSGLEKRFEGQR 297
            |    :..||        :|....:....||           |:.||.|:..|:|.|||.|:..|
 Frog   171 D----ATVSL--------SPNDTSDEEGKLG-----------RRLRTAFTSDQISTLEKTFQKHR 212

  Fly   298 YLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLR-RRDNANEPVDF 345
            ||...||.:||..|.|||.|:||||||||||:|:::: .|.::..|..|
 Frog   213 YLGASERRKLAAKLQLSEVQIKTWFQNRRMKYKREIQDGRPDSYHPAQF 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 31/51 (61%)
ventx2.2XP_002937178.3 Homeobox 193..246 CDD:395001 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.