DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and LOC100361016

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_008771600.2 Gene:LOC100361016 / 100361016 RGDID:2320944 Length:335 Species:Rattus norvegicus


Alignment Length:302 Identity:78/302 - (25%)
Similarity:113/302 - (37%) Gaps:92/302 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 QLGSGAAQHPPVPTTQP-QPPPPPP---LN----GGSGASNGVLYPNAPYTDHGF--LQMTLGYL 222
            |:|    |.|.|.:..| |..|..|   ||    .||...:.:.....|..|.|.  |:...|:.
  Rat    18 QMG----QSPLVTSRTPMQSSPSVPEQNLNWQESQGSSRESSIQMQPGPVMDPGLPTLRSPSGHP 78

  Fly   223 S------PS--SGTYKSVDPYFLSQASLFGGAPFFGAPGCVPELALGLGMGVNALRHCRRRKART 279
            |      ||  ||.:..::|..||..  :||..                .|..|.|  :|||.||
  Rat    79 SHQRPSTPSSRSGFHVPIEPMALSDK--YGGKQ----------------TGPVAPR--KRRKERT 123

  Fly   280 VFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRDNANEPVD 344
            .:|..|.|.|::.|...:|....:.:|||:.:.::|.::|.||:|.|.|.|::       |.|  
  Rat   124 QYSAKQKSVLQEHFAECQYPDKKQCLELASLVRVTEKEIKVWFKNNRAKCKQK-------NVP-- 179

  Fly   345 FSRSEPGKQPG-EATSSSGDSKHGKLNPGS------------------VGGTPTQPTSEQQ---- 386
              .:.|.|..| ||.|.|.|.      |||                  |..||....|::.    
  Rat   180 --EALPEKNGGPEAVSGSTDF------PGSIAVVGCDQGEPMATAILDVDSTPKLNCSQESSLDG 236

  Fly   387 ------LQMCLMQQGYSTDDYSDLEADSGDEDNSSDVDIVGD 422
                  ...||.:....::|    ...:||...|:.|:...|
  Rat   237 NWTYDGAMCCLPEDVLDSND----PVTAGDSGVSAPVEAQAD 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 18/51 (35%)
LOC100361016XP_008771600.2 HOX 118..174 CDD:197696 21/55 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.