DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and ventx3.2

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001123388.1 Gene:ventx3.2 / 100170150 XenbaseID:XB-GENE-483077 Length:282 Species:Xenopus tropicalis


Alignment Length:57 Identity:31/57 - (54%)
Similarity:40/57 - (70%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 KARTVFSDPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQ 332
            :|||.|:..||..|||.|:..||:.:.|:..|:..|.|||.|:||||||||||.|:|
 Frog   131 RARTKFTAEQLEELEKSFKENRYIGSSEKRRLSKVLKLSENQIKTWFQNRRMKFKRQ 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 28/51 (55%)
ventx3.2NP_001123388.1 Homeobox 133..186 CDD:365835 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.