DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsh and bsx

DIOPT Version :9

Sequence 1:NP_477350.2 Gene:bsh / 35266 FlyBaseID:FBgn0000529 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001095280.1 Gene:bsx / 100124316 XenbaseID:XB-GENE-995770 Length:229 Species:Xenopus tropicalis


Alignment Length:276 Identity:102/276 - (36%)
Similarity:125/276 - (45%) Gaps:79/276 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 GDQISQQLGSGAAQ----HPPVPTTQPQPPPPPPLNGGSGASNGVLYPNAPYTDHGFLQM---TL 219
            |.|:||:..|...:    |.|.|..:            |...........|..|:|:..|   |:
 Frog     9 GHQVSQRPTSFFIEDILLHKPKPLRE------------SSTHFSSFTSRVPILDYGYPLMPTPTI 61

  Fly   220 GYLSPSSGTYK--SVDPYFLSQASLFGGAPFFGAPGCVPELALGLGMGVNALRHCRRRKARTVFS 282
            ....|....:|  ...|:||:.:    |.|   .|...|..:...|      :||||||||||||
 Frog    62 LAPHPHHPLHKPDHHHPFFLATS----GLP---VPALFPHHSELPG------KHCRRRKARTVFS 113

  Fly   283 DPQLSGLEKRFEGQRYLSTPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRDN------ANE 341
            |.||||||||||.||||||||||||||||.||||||||||||||||||||||:..:      ::.
 Frog   114 DSQLSGLEKRFELQRYLSTPERVELATALSLSETQVKTWFQNRRMKHKKQLRKTQDDPKTAMSDN 178

  Fly   342 PVDFSRSEPGKQPGEATSSSGDSKHGKLNPGSVGGTPTQPTSEQQLQMCLMQQGYSTDDYSDLEA 406
            .:|.|.||         :.|||.          .||.......|.|        :..|:..|   
 Frog   179 HLDHSSSE---------TESGDP----------NGTERAKGGSQNL--------FLRDEAED--- 213

  Fly   407 DSGDEDNSSDVDIVGD 422
                     :|||:.|
 Frog   214 ---------EVDIIED 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bshNP_477350.2 Homeobox 278..330 CDD:278475 48/51 (94%)
bsxNP_001095280.1 Homeobox 109..162 CDD:365835 49/52 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6390
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006209
OrthoInspector 1 1.000 - - oto104269
Panther 1 1.100 - - O PTHR24327
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3788
SonicParanoid 1 1.000 - - X4485
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.040

Return to query results.
Submit another query.