DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fbp and AT5G64380

DIOPT Version :9

Sequence 1:NP_724223.4 Gene:fbp / 35265 FlyBaseID:FBgn0032820 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_201243.1 Gene:AT5G64380 / 836559 AraportID:AT5G64380 Length:404 Species:Arabidopsis thaliana


Alignment Length:340 Identity:140/340 - (41%)
Similarity:195/340 - (57%) Gaps:30/340 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DSNAMTLTRFVLQEQRKFKSATGDLSQLLNSIQTAIKATSSAVR---KAGIAKLHGFAGDVNVQG 79
            |....||..|......:.|:...||..||..:|.|.|..:|.|.   .:.:.||     .||...
plant    66 DDGYCTLIDFAGSGGGEGKNVGEDLVVLLYHLQHACKRIASLVASPFNSSLGKL-----SVNSSS 125

  Fly    80 ----EEVKKLDVLSNELFINMLKSSYTTCLMVSEENENVIEVEVEKQGKYIVCFDPLDGSSNIDC 140
                :..|.||::||::.::.|::|....:|.||||::  ...::..|.|:|..||||||.|||.
plant   126 GSDRDAPKPLDIVSNDIVLSSLRNSGKVAVMASEENDS--PTWIKDDGPYVVVVDPLDGSRNIDA 188

  Fly   141 LVSIGSIFAIYRK--KSDGPPTVEDA----LQPGNQLVAAGYALYGSATAIVLGLGSGVNGFTYD 199
            .:..|:||.||.:  :.|..|..|.|    ||.|::|||:||.||.|||...:.||||.:.||.|
plant   189 SIPTGTIFGIYNRLVELDHLPVEEKAELNSLQRGSRLVASGYVLYSSATIFCVTLGSGTHAFTLD 253

  Fly   200 PAIGEFVLTDPNMRVPEKGKIYSINEGYAADWEDGVFNYIAAKKDPAKG---KPYGARYVGSMVA 261
            .:.||||||..|:::|.:|:|||:|:....||.:|:..||...:. .||   |.|.|||:.|:||
plant   254 HSTGEFVLTHQNIKIPTRGQIYSVNDARYFDWPEGLRKYIDTVRQ-GKGQNPKKYSARYICSLVA 317

  Fly   262 DVHRTIKYGGIFIYPATKSAPSGKLRLLYECVPMAYLMIQAGGLASDGKISILDIVPKKIHERSP 326
            |:|||:.|||:.:      .|...|||:||..|:|:|:.||||.:||||..||.|.|.|:|:|.|
plant   318 DLHRTLLYGGVAM------NPRDHLRLVYEGNPLAFLVEQAGGKSSDGKRGILSIQPVKLHQRLP 376

  Fly   327 IFLGSKSDVEEALSY 341
            :||||..||.|..||
plant   377 LFLGSLEDVAELESY 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fbpNP_724223.4 FBPase 28..342 CDD:238214 136/330 (41%)
AT5G64380NP_201243.1 PLN02628 49..404 CDD:215337 140/340 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1381522at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11556
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.