DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10463 and Dus4l

DIOPT Version :9

Sequence 1:NP_610000.1 Gene:CG10463 / 35264 FlyBaseID:FBgn0032819 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_082278.1 Gene:Dus4l / 71916 MGIID:1919166 Length:324 Species:Mus musculus


Alignment Length:249 Identity:63/249 - (25%)
Similarity:110/249 - (44%) Gaps:30/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 VLSPLTTLGNLPFRRICKEFGADITCGEMACAQPLLKGMGQEWALTKRHQSEDVFGVQLCGNNPN 324
            |.:|:.....|.||.:.:::..|:....|..|...::.:....:....:|.:....||...|:..
Mouse    30 VCAPMVRYSKLAFRTLVRKYSCDLCYTPMIIAADFVRSIKARDSEFTTNQGDCPLIVQFAANDAR 94

  Fly   325 MLNQAAQVIHETAQVDFIDLNIGCPIDLIYQQGGGSALMRRTNILELTVRSCAALSDRLPFTVKM 389
            :|:.||.::...|  :.||:|.|||.......|.|:.|:.:..::...||......:...|:|.:
Mouse    95 LLSDAALLVCPYA--NGIDINCGCPQRWAMADGYGACLINKPELVHDMVRQVRNRVESPRFSVSI 157

  Fly   390 RTGIYADKSVAHELLPLVEEWGASAVTLHGRSREQRYTKHANWAY-----IEECAAKAKCMPVIG 449
            :..|:.|.:...:|....|..|.|.:|:|||:.|:|   |....|     |:|..:    :|::.
Mouse   158 KIRIHDDLARTIDLCRKAEATGVSWITVHGRTVEER---HQPVHYDAIKMIKENVS----IPIVA 215

  Fly   450 NGDILSYEDYMERRTLAPHVC------SVMIGRGALIKPWIF---QEIKEKQAW 494
            ||||.|.::       |.:|.      .||:.||.|..|.:|   :|...|..|
Mouse   216 NGDIRSLKE-------AENVWQMTGTDGVMVARGLLTNPAMFAGYEETPLKCIW 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10463NP_610000.1 DusA 253..547 CDD:223120 63/249 (25%)
DUS_like_FMN 258..492 CDD:239200 61/245 (25%)
Dus4lNP_082278.1 DUS_like_FMN 28..257 CDD:239200 61/242 (25%)
DusA 32..311 CDD:223120 62/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0042
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.