DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10463 and DUS2

DIOPT Version :9

Sequence 1:NP_610000.1 Gene:CG10463 / 35264 FlyBaseID:FBgn0032819 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_001258691.1 Gene:DUS2 / 54920 HGNCID:26014 Length:493 Species:Homo sapiens


Alignment Length:284 Identity:80/284 - (28%)
Similarity:129/284 - (45%) Gaps:42/284 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 FREKLVLSPLTTLGNLPFRRICKEFGADIT-CGEMACAQPL-LKGMGQEWALT------------ 305
            :..||:|:|:..:|.||.|.:..::||||. |.|:...:.: .|.:..|...|            
Human    10 YHNKLILAPMVRVGTLPMRLLALDYGADIVYCEELIDLKMIQCKRVVNEVLSTVDFVAPDDRVVF 74

  Fly   306 ---KRHQSEDVFGVQLCGNNPNMLNQAAQVIHETAQVDFIDLNIGCPIDLIYQQGGGSALMRRTN 367
               :|.|:..||  |:..::.......|:::..  .|..||:|:|||.....:.|.|:||:...:
Human    75 RTCEREQNRVVF--QMGTSDAERALAVARLVEN--DVAGIDVNMGCPKQYSTKGGMGAALLSDPD 135

  Fly   368 ILELTVRSCAALSDRLPFTVKMRTGIYADKSVAHELLPLVEEWGASAVTLHGRSREQRYTKHANW 432
            .:| .:.|......|.|.|.|:|  |.........|:..:|..|.:|:.:|||.||:| .:|...
Human   136 KIE-KILSTLVKGTRRPVTCKIR--ILPSLEDTLSLVKRIERTGIAAIAVHGRKREER-PQHPVS 196

  Fly   433 AYIEECAAKAKCMPVIGNG----DILSYEDYMERRTLAPHVCSVMIGRGALIKPWIFQEIKEKQA 493
            ..:.:..|....:|||.||    .|..|.|..:.|. |....|||:.|.|:..|.||  :||   
Human   197 CEVIKAIADTLSIPVIANGGSHDHIQQYSDIEDFRQ-ATAASSVMVARAAMWNPSIF--LKE--- 255

  Fly   494 WSPSSGQR--YEMLQKFCNYGLEH 515
                 |.|  .|::||:..|.:::
Human   256 -----GLRPLEEVMQKYIRYAVQY 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10463NP_610000.1 DusA 253..547 CDD:223120 80/284 (28%)
DUS_like_FMN 258..492 CDD:239200 74/254 (29%)
DUS2NP_001258691.1 Catalytic domain. /evidence=ECO:0000269|PubMed:26429968 1..333 80/284 (28%)
DUS_like_FMN 13..252 CDD:239200 70/247 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 330..349
Interaction with tRNA. /evidence=ECO:0000269|PubMed:30605527 367..371
DSRM 369..433 CDD:238007
Interaction with tRNA. /evidence=ECO:0000269|PubMed:30605527 420..424
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 438..493
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0042
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.