DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10463 and CG3645

DIOPT Version :9

Sequence 1:NP_610000.1 Gene:CG10463 / 35264 FlyBaseID:FBgn0032819 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_001259809.1 Gene:CG3645 / 33190 FlyBaseID:FBgn0031238 Length:505 Species:Drosophila melanogaster


Alignment Length:392 Identity:91/392 - (23%)
Similarity:158/392 - (40%) Gaps:80/392 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 DAEKQTDTKSKPTATGCAIDDSAIGRDADHKPAVDFREKLVLSPLTTLGNLPFRRICKEFGADIT 284
            |.:......|||  ||.....|::|           ..:.|::|:.....|.:|.:|:.:||:: 
  Fly     4 DEDAAHQRPSKP--TGYNFYRSSLG-----------SPRYVVAPMVDQSELAWRMLCRRYGAEL- 54

  Fly   285 CGEMACAQPLLKGMGQEWALTKRHQSEDV--------FGVQLCGNNPNMLNQAAQVIHETAQVDF 341
                 |..|:..  ...:|...:::.:.:        ..:|.|||:...:..||.:..:  ..|.
  Fly    55 -----CYSPMYH--ANLFATDPKYRKDALQTCPEDRPLIIQFCGNDAQQILDAALLAQD--HCDA 110

  Fly   342 IDLNIGCPIDLIYQQGGGSALMRRTNIL-ELTVRSCAALSDRLPFTVKMRTGIYADKSVAHELLP 405
            :|:|:|||..:..:...||.|.....:| |:.....|.|:  :|.|.|:|  |:.|.........
  Fly   111 VDINLGCPQAIAKRGHYGSFLQDEWELLTEIVSTLHAKLA--VPVTCKIR--IFEDLEKTIRYAK 171

  Fly   406 LVEEWGASAVTLHGRSREQR--YTKHANWAYIEECAAKAKCMPVIGNGDILSYEDYMERRTLAPH 468
            ::|..|...:|:|||:|||:  .|..|||.||:......| :|::.||:||:.:| :.|......
  Fly   172 MLEAAGCQLLTVHGRTREQKGPLTGVANWNYIKNVRQHIK-IPMLANGNILALDD-VHRCLTETG 234

  Fly   469 VCSVMIGRGALIKPWIFQEIKEKQAWS--------------PSSGQRYEMLQKFCNYGLEHWGSD 519
            |..||...|.|..|.||:.: ....|.              |||..|..:.:.|.:.......|:
  Fly   235 VDGVMSAEGNLHNPAIFKGV-SPPVWQMAHEYLELVQLHPCPSSFIRGHLFKLFHHIMNIRQNSE 298

  Fly   520 TKGVETTRRFLLEWQSFLYR--------------YIPEALQTAPPQK-----------INARPQK 559
            .:....|...|:::|:.:.:              |.||.:.....:.           |.|.|:.
  Fly   299 LRQYLATANQLVQFQAVVQQVRAKYEPFHKGEVPYEPEQMAAGSEEDLPLSPWLCQPYIRASPES 363

  Fly   560 YR 561
            :|
  Fly   364 HR 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10463NP_610000.1 DusA 253..547 CDD:223120 79/332 (24%)
DUS_like_FMN 258..492 CDD:239200 66/244 (27%)
CG3645NP_001259809.1 DUS_like_FMN 29..259 CDD:239200 66/246 (27%)
Dus 31..303 CDD:279540 73/288 (25%)
put_zinc_LRP1 426..>460 CDD:130684
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464257
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0042
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.