DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10463 and dus-2

DIOPT Version :9

Sequence 1:NP_610000.1 Gene:CG10463 / 35264 FlyBaseID:FBgn0032819 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_493554.1 Gene:dus-2 / 173331 WormBaseID:WBGene00013201 Length:436 Species:Caenorhabditis elegans


Alignment Length:283 Identity:75/283 - (26%)
Similarity:129/283 - (45%) Gaps:45/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 FREKLVLSPLTTLGNLPFRRICKEFGADITCGEMACAQPLLKGM--------------GQEWALT 305
            :|.|.:|:|:...|..|.|.:|.::|||:...|....:.|::..              |.:..|.
 Worm     5 YRNKKILAPMVRAGRTPLRLLCLKYGADLCYTEEIVDKKLIEATRVVNEALGTIDYRNGDDIILR 69

  Fly   306 KRHQSEDVFGVQLCGNNPNMLNQAAQVIHETAQVDFIDLNIGCPIDLIYQQGGGSALMRRT-NIL 369
            ...:.:....:|:..|:.....:.||::.:  .|..||:|:|||.......|.|:||:.:| .|:
 Worm    70 LAPEEKGRCILQIGTNSGEKAAKIAQIVGD--DVAGIDVNMGCPKPFSIHCGMGAALLTQTEKIV 132

  Fly   370 EL--TVRSCAALSDRLPFTVKMRTGIYADKSVAHELLPLVEEWGASAVTLHGRSREQRYTKHANW 432
            ::  :::|.|    ::|.|.|:|  :..|.....:|:..:|:...||:.:|||.|::|.......
 Worm   133 DILTSLKSAA----KVPVTCKIR--VLDDPEDTLKLVQEIEKCRVSALGVHGRRRDERQPDKCRI 191

  Fly   433 AYIEECAAKAKCMPVIGNG---DILSYEDYMERRTLAPHVCSVMIGRGALIKPWIFQEIKEKQAW 494
            ..|.:.|...:.:|||.||   :|..|.|: |:..|.....|.||.|.||..|.||:.       
 Worm   192 DEIRDVAQAVQSIPVISNGLSDEIEQYSDF-EKYQLLTETSSTMIARKALSTPSIFRR------- 248

  Fly   495 SPSSG--QRYEMLQKF----CNY 511
               .|  .:||.::.|    |.|
 Worm   249 ---EGCLDKYEDIRNFLELACQY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10463NP_610000.1 DusA 253..547 CDD:223120 75/283 (27%)
DUS_like_FMN 258..492 CDD:239200 68/253 (27%)
dus-2NP_493554.1 DUS_like_FMN 8..248 CDD:239200 68/248 (27%)
DSRM_SF 359..425 CDD:381777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0042
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.