DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10631 and STP4

DIOPT Version :9

Sequence 1:NP_609998.1 Gene:CG10631 / 35262 FlyBaseID:FBgn0032817 Length:3781 Species:Drosophila melanogaster
Sequence 2:NP_010235.1 Gene:STP4 / 851512 SGDID:S000002206 Length:490 Species:Saccharomyces cerevisiae


Alignment Length:460 Identity:96/460 - (20%)
Similarity:157/460 - (34%) Gaps:132/460 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   846 PPPTAPNSHSSGLQHQTQQHSSQHSLQQQL--HSKSYHRQSAASTSSSASSANSHYVDPDLSASY 908
            |||....|:||......|..:|..:....|  :||.|...|.:.|..| |:::||.:.|.:| |:
Yeast    76 PPPPLTTSYSSYNSSACQSITSSPTDNTALAHNSKCYFPHSLSPTPLS-SNSSSHVILPPIS-SF 138

  Fly   909 LGL---------GASGSSAMNASDSMDVCCVPSCESKRHNNE-------NIT-FHTI-PRRPEQM 955
            ..|         |.|.|...|.:..     ||......|.:|       |.| |.|| |..|.| 
Yeast   139 TNLITVAEREFNGRSNSLHANFTSP-----VPRTVLDHHRHELTFCNPNNTTGFKTITPSPPTQ- 197

  Fly   956 RKWCHNLKIPE--EKMHKGMRICSL---HFEPYCI--------GGCMRPFAVPTLNLGHDDDDIH 1007
                |...:|.  :.:.:...:.||   .|.|..:        .......|:|:::....::...
Yeast   198 ----HQSILPTAVDNVPRSKSVSSLPVSGFPPLIVKQQQQQQLNSSSSASALPSIHSPLTNEHTS 258

  Fly  1008 RNPDVIKKLNIRETCCVAVCKRNRDRDHANLHRFPSNVSLLTKWCGNL---QRPVPDGSKLFNDA 1069
            |....:|.       ...:.|:.:.::....|.|.:|:|  |....:|   .||       ....
Yeast   259 RYSSSLKD-------SAKITKQRKKKECPICHNFYANLS--THKSTHLTPEDRP-------HKCP 307

  Fly  1070 ICEVHFEER--CLRNKRLEKWAVPTLSLGHENIPYPLPTPEQVTEFYSRPTAPNNGEEQGECCVE 1132
            ||:..|...  .:|:|: ..|                  .::..:.|:|.:..|:|.:..:....
Yeast   308 ICQRGFARNNDLIRHKK-RHW------------------KDEFMQIYARESDNNSGADDQDDTAR 353

  Fly  1133 TCKRNPSVDD---IKLYRPPEEASVLAKWAHNLQTESSQLTSMRICNLHFEAHCIGKRMRPWAIP 1194
            |...|.|.|.   :......||..:|.|         :||.|:......|:.        |:...
Yeast   354 TSANNDSDDSNDKLAASSSSEETKLLKK---------NQLKSLYKIKGAFKC--------PYNST 401

  Fly  1195 TLNLAGTI-----ENLYENP---EHSMLYKR----RTHMKA----------KQSASVKPTWVPRC 1237
            .:||...:     .:||..|   ..:.::.|    :.|:||          |:...|    ||..
Yeast   402 LINLDMEVYPHKSRSLYFEPINCHQTGVFSRCDTFKNHLKALHFEYPPKTKKEDRGV----VPGK 462

  Fly  1238 CLPHC 1242
            | .||
Yeast   463 C-KHC 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10631NP_609998.1 C2H2 Zn finger 288..311 CDD:275368
C2H2 Zn finger 319..339 CDD:275368
DM3 584..642 CDD:128933
DM3 683..738 CDD:128933
DM3 775..832 CDD:128933
DM3 945..1000 CDD:128933 14/68 (21%)
DM3 1038..1096 CDD:128933 14/62 (23%)
DM3 1145..1198 CDD:128933 9/52 (17%)
THAP 1236..1308 CDD:214951 3/7 (43%)
DM3 1349..1406 CDD:128933
THAP 1424..1493 CDD:214951
DM3 1538..1596 CDD:128933
DM3 1683..1739 CDD:128933
DM3 1778..1831 CDD:128933
DM3 1980..2033 CDD:128933
DM3 2147..2202 CDD:128933
DM3 2308..2365 CDD:128933
DM3 2434..2491 CDD:128933
DM3 2539..2598 CDD:128933
DM3 2622..2680 CDD:128933
DM3 2718..2775 CDD:128933
DM3 2907..2965 CDD:128933
DM3 3098..3155 CDD:128933
DM3 3227..3284 CDD:128933
DM3 3396..3452 CDD:128933
DM3 3544..3601 CDD:128933
THAP 3621..>3669 CDD:283206
DM3 3690..3748 CDD:128933
STP4NP_010235.1 COG5048 14..442 CDD:227381 87/429 (20%)
C2H2 Zn finger 279..296 CDD:275368 5/18 (28%)
C2H2 Zn finger 306..326 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.