DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10631 and STP3

DIOPT Version :9

Sequence 1:NP_609998.1 Gene:CG10631 / 35262 FlyBaseID:FBgn0032817 Length:3781 Species:Drosophila melanogaster
Sequence 2:NP_013479.3 Gene:STP3 / 851089 SGDID:S000004367 Length:343 Species:Saccharomyces cerevisiae


Alignment Length:320 Identity:61/320 - (19%)
Similarity:99/320 - (30%) Gaps:83/320 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 QQQQQQQQQQQHQHQHLPQHISQQRPYMGHNIMTGSYPYIKSEPMEAYQQPPNPMAPPPAPEVLI 216
            ::|...:......|..||          ..||..||.....|..|.:||..|:            
Yeast    28 ERQYNGEASSASTHPTLP----------NMNISNGSGSAGASSSMLSYQLLPH------------ 70

  Fly   217 KSEPIDEHSYKSNYIDD-NTPFADFSKFSEFSED-----MLSPKVELTVKDESYGRTTSSFLRRK 275
             |..:...:..|:::.. ..|....:..||.|..     .:||.:::.......|...|:....|
Yeast    71 -SNDVSRSNSSSSFLPSVQQPTEGSASASETSSSASPSRSISPILKVAGPSSVGGAGVSTPHSTK 134

  Fly   276 QQSDRGNESLPICQRCKEVFFKKQVYLRHVAESNCGIQEYDFKCSTCPMSFMTTEELQRHKLHHR 340
            ....|..:..|||:.    |:..  ...|.| ::...::...||..|...|....:|.|||..|.
Yeast   135 INKPRKKKQCPICRN----FYAN--LTTHKA-THLTPEDRPHKCPICHRGFARNNDLLRHKKRHW 192

  Fly   341 ADRFFCHK-YCGKHFD------TIAECEAHEYMQHEYDSFVCNMCSGTFATREQLYAHLPQ-HKF 397
            .|...... ....|.|      :..:.:.||.|        ..|.|.|.      ||.|.. |:.
Yeast   193 KDEILSQSGVLSNHNDGKGGSVSPNDDDTHEKM--------TPMNSVTD------YAQLKSLHQI 243

  Fly   398 QQRFDCPICRLWYQTALELHEHRLAAPYFCGKYYTGGQSSSASQSQAQQHQTNYKLQDCH 457
            :..|.||......|..::::.::|                         ...|::..:||
Yeast   244 KGTFKCPFNSTLIQLDMDMYPYKL-------------------------KPLNFETSNCH 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10631NP_609998.1 C2H2 Zn finger 288..311 CDD:275368 4/22 (18%)
C2H2 Zn finger 319..339 CDD:275368 7/19 (37%)
DM3 584..642 CDD:128933
DM3 683..738 CDD:128933
DM3 775..832 CDD:128933
DM3 945..1000 CDD:128933
DM3 1038..1096 CDD:128933
DM3 1145..1198 CDD:128933
THAP 1236..1308 CDD:214951
DM3 1349..1406 CDD:128933
THAP 1424..1493 CDD:214951
DM3 1538..1596 CDD:128933
DM3 1683..1739 CDD:128933
DM3 1778..1831 CDD:128933
DM3 1980..2033 CDD:128933
DM3 2147..2202 CDD:128933
DM3 2308..2365 CDD:128933
DM3 2434..2491 CDD:128933
DM3 2539..2598 CDD:128933
DM3 2622..2680 CDD:128933
DM3 2718..2775 CDD:128933
DM3 2907..2965 CDD:128933
DM3 3098..3155 CDD:128933
DM3 3227..3284 CDD:128933
DM3 3396..3452 CDD:128933
DM3 3544..3601 CDD:128933
THAP 3621..>3669 CDD:283206
DM3 3690..3748 CDD:128933
STP3NP_013479.3 COG5048 <137..295 CDD:227381 37/188 (20%)
C2H2 Zn finger 144..161 CDD:275368 6/23 (26%)
C2H2 Zn finger 171..191 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.