DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10631 and ZNF671

DIOPT Version :9

Sequence 1:NP_609998.1 Gene:CG10631 / 35262 FlyBaseID:FBgn0032817 Length:3781 Species:Drosophila melanogaster
Sequence 2:NP_079109.2 Gene:ZNF671 / 79891 HGNCID:26279 Length:534 Species:Homo sapiens


Alignment Length:275 Identity:65/275 - (23%)
Similarity:102/275 - (37%) Gaps:58/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 DFSKFSEFSEDMLSPKVEL-TVKDESYGRTTSSFLRRKQQSDRGNESLPICQRCKEVFFKKQVYL 302
            |||..|    .:|..:..| ::|.....:..|.|| ..|:..|       |..|.:.|.:|....
Human   249 DFSATS----GLLQHQASLSSMKPHKSTKLVSGFL-MGQRYHR-------CGECGKAFTRKDTLA 301

  Fly   303 RHVA--------ESN-CG---IQEYD-------------FKCSTCPMSFMTTEELQRHKLHHRAD 342
            ||..        |.| ||   .|.||             ::||.|...|.....|..|:..|..:
Human   302 RHQRIHTGERPYECNECGKFFSQSYDLFKHQTVHTGERPYECSECGKFFRQISGLIEHRRVHTGE 366

  Fly   343 RFF-CHKYCGKHFDTIAECEAHEYMQHEYDSFVCNMCSGTFATREQLYAHLPQHKFQQRFDCPIC 406
            |.: |.| |||.|.:.:....|:.:......:||:.|...|:.:..|..|...|..::.::|..|
Human   367 RLYQCGK-CGKFFSSKSNLIRHQEVHTGARPYVCSECGKEFSRKHTLVLHQRTHTGERPYECSEC 430

  Fly   407 RLWYQTALELHEH-RLAAPYF----CGKYYTGGQSSSASQSQAQQHQ------TNYKLQDCHMAT 460
            ...:..:..|:.| |:.:..:    |||.:       :..|:..|||      ..|:...|..|.
Human   431 GKAFSQSSHLNVHWRIHSSDYECSRCGKAF-------SCISKLIQHQKVHSGEKPYECSKCGKAF 488

  Fly   461 MEMPTTPHHKTTPSG 475
            .:.|....|....:|
Human   489 TQRPNLIRHWKVHTG 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10631NP_609998.1 C2H2 Zn finger 288..311 CDD:275368 8/31 (26%)
C2H2 Zn finger 319..339 CDD:275368 6/19 (32%)
DM3 584..642 CDD:128933
DM3 683..738 CDD:128933
DM3 775..832 CDD:128933
DM3 945..1000 CDD:128933
DM3 1038..1096 CDD:128933
DM3 1145..1198 CDD:128933
THAP 1236..1308 CDD:214951
DM3 1349..1406 CDD:128933
THAP 1424..1493 CDD:214951
DM3 1538..1596 CDD:128933
DM3 1683..1739 CDD:128933
DM3 1778..1831 CDD:128933
DM3 1980..2033 CDD:128933
DM3 2147..2202 CDD:128933
DM3 2308..2365 CDD:128933
DM3 2434..2491 CDD:128933
DM3 2539..2598 CDD:128933
DM3 2622..2680 CDD:128933
DM3 2718..2775 CDD:128933
DM3 2907..2965 CDD:128933
DM3 3098..3155 CDD:128933
DM3 3227..3284 CDD:128933
DM3 3396..3452 CDD:128933
DM3 3544..3601 CDD:128933
THAP 3621..>3669 CDD:283206
DM3 3690..3748 CDD:128933
ZNF671NP_079109.2 KRAB 49..109 CDD:214630
KRAB 49..88 CDD:279668
C2H2 Zn finger 243..269 CDD:275368 7/23 (30%)
COG5048 <285..443 CDD:227381 39/165 (24%)
zf-C2H2 285..307 CDD:278523 7/28 (25%)
C2H2 Zn finger 287..307 CDD:275368 6/19 (32%)
zf-H2C2_2 300..324 CDD:290200 6/23 (26%)
C2H2 Zn finger 315..335 CDD:275368 6/19 (32%)
zf-H2C2_2 327..352 CDD:290200 5/24 (21%)
C2H2 Zn finger 343..363 CDD:275368 6/19 (32%)
zf-C2H2 369..391 CDD:278523 7/22 (32%)
C2H2 Zn finger 371..391 CDD:275368 7/20 (35%)
zf-C2H2 397..419 CDD:278523 6/21 (29%)
C2H2 Zn finger 399..419 CDD:275368 5/19 (26%)
zf-H2C2_2 412..436 CDD:290200 5/23 (22%)
C2H2 Zn finger 427..447 CDD:275368 5/19 (26%)
C2H2 Zn finger 453..473 CDD:275368 7/26 (27%)
zf-H2C2_2 466..490 CDD:290200 6/23 (26%)
C2H2 Zn finger 481..501 CDD:275368 4/19 (21%)
C2H2 Zn finger 509..529 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156324
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.