DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10631 and Thap2

DIOPT Version :10

Sequence 1:NP_609998.1 Gene:CG10631 / 35262 FlyBaseID:FBgn0032817 Length:3781 Species:Drosophila melanogaster
Sequence 2:NP_080056.1 Gene:Thap2 / 66816 MGIID:1914066 Length:217 Species:Mus musculus


Alignment Length:158 Identity:40/158 - (25%)
Similarity:64/158 - (40%) Gaps:32/158 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  3079 HCAVEGCEVTVEDVGGTIKLHKFPASSEAARKWMHNTQ----VDMDEKFWWRYRICSYHFEQECF 3139
            :||..||..|. :....|..|:||...:..::|:...:    |.....|     :||.|||..||
Mouse     4 NCAAAGCAATY-NKHINISFHRFPLDPKRRKEWVRLVRRKNFVPGKHTF-----LCSKHFEASCF 62

  Fly  3140 ----QSARIKKGAMPTLL--------LGPKRPDKVYDN---------EFALQETEELILPEDLEF 3183
                |:.|:|..|:||:.        |..|..:.:..|         ...|..:::::|.....|
Mouse    63 DLTGQTRRLKMDAVPTIFDFCTHIKSLKLKSRNLLKTNNSFPPTGPCNLKLNGSQQVLLEHSYAF 127

  Fly  3184 EDTKKPKREVIKLCLPTPAPPRKSSKFC 3211
            .:..:.|:.:||| ....|..||..|.|
Mouse   128 RNPMEAKKRIIKL-EKEIASLRKKMKTC 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10631NP_609998.1 C2H2 Zn finger 288..311 CDD:275368
C2H2 Zn finger 319..339 CDD:275368
DM3 584..642 CDD:128933
DM3 683..738 CDD:128933
DM3 775..832 CDD:128933
DM3 945..1000 CDD:128933
DM3 1038..1096 CDD:128933
DM3 1145..1198 CDD:128933
THAP 1236..1308 CDD:214951
DM3 1349..1406 CDD:128933
THAP 1424..1493 CDD:214951
DM3 1538..1596 CDD:128933
DM3 1683..1739 CDD:128933
DM3 1778..1831 CDD:128933
DM3 1980..2033 CDD:128933
DM3 2147..2202 CDD:128933
DM3 2308..2365 CDD:128933
DM3 2434..2491 CDD:128933
DM3 2539..2598 CDD:128933
DM3 2622..2680 CDD:128933
DM3 2718..2775 CDD:128933
DM3 2907..2965 CDD:128933
DM3 3098..3155 CDD:128933 19/72 (26%)
DM3 3227..3284 CDD:128933
DM3 3396..3452 CDD:128933
DM3 3544..3601 CDD:128933
THAP 3622..>3673 CDD:461662
DM3 3690..3748 CDD:128933
Thap2NP_080056.1 THAP 5..80 CDD:461662 25/80 (31%)
HCFC1-binding motif (HBM). /evidence=ECO:0000250 122..125 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.