DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10631 and Zfp667

DIOPT Version :9

Sequence 1:NP_609998.1 Gene:CG10631 / 35262 FlyBaseID:FBgn0032817 Length:3781 Species:Drosophila melanogaster
Sequence 2:NP_001020099.1 Gene:Zfp667 / 384763 MGIID:2442757 Length:609 Species:Mus musculus


Alignment Length:300 Identity:72/300 - (24%)
Similarity:119/300 - (39%) Gaps:55/300 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 ESYGRTTSSFLRRKQQSDRGNESLPI-CQRCKEVFFKKQVYLRHVAESNCGIQEYDFKCSTCP-- 323
            :|:.|.::..|.::..:. ||   |. |.:|::.|.:....:.|: ..:.|  |..||||.|.  
Mouse   336 KSFSRISALMLHQRIHTS-GN---PYKCDKCQKDFGRLSTLILHL-RIHSG--EKQFKCSKCEKV 393

  Fly   324 ----MSFMTTEELQRHKLHHRADRFFCHKYCGKHFDTIAECEAHEYMQHEYDSFVCNMCSGTFAT 384
                .||     :|..|:|.|..:....|.|||.|..:...:.|..:..|...|.||.||..|..
Mouse   394 CSRLSSF-----IQHQKIHKRKKKLIACKECGKMFGGMKNLKVHLNIHSEEKPFKCNKCSKVFGR 453

  Fly   385 REQLYAHLPQHKFQQRFDCPICRLWYQTALELHEHRLA----APY---FCGKYYTGGQSSSASQS 442
            :..|..|...|..::.:.|..|...:...:.|..|:..    .||   .|||.:    |.||..:
Mouse   454 QSFLSEHQRIHTGEKPYQCEECGKAFSHRISLTRHKRIHSEDRPYECDLCGKAF----SQSAHLA 514

  Fly   443 QAQQHQTN---YKLQDCHMATMEMPTTPHHKTTPSGSSLPATAALNSLLQQRQANADGAAMFAAS 504
            |.::..|.   |..:.|..:..:..:...|:.:.:|.            :..:.|..|.|..:.|
Mouse   515 QHERIHTGEKPYACKICKKSFAQRISLILHERSHTGE------------RPYECNECGKAFSSGS 567

  Fly   505 AMKNEVNVKMERSYSNSTSESSYSVQDSGYNNAYGSDSSM 544
            .:     ::.:||:|   ||..|.....|  .||...||:
Mouse   568 DL-----IRHQRSHS---SEKPYECSKCG--KAYSRSSSL 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10631NP_609998.1 C2H2 Zn finger 288..311 CDD:275368 4/22 (18%)
C2H2 Zn finger 319..339 CDD:275368 7/25 (28%)
DM3 584..642 CDD:128933
DM3 683..738 CDD:128933
DM3 775..832 CDD:128933
DM3 945..1000 CDD:128933
DM3 1038..1096 CDD:128933
DM3 1145..1198 CDD:128933
THAP 1236..1308 CDD:214951
DM3 1349..1406 CDD:128933
THAP 1424..1493 CDD:214951
DM3 1538..1596 CDD:128933
DM3 1683..1739 CDD:128933
DM3 1778..1831 CDD:128933
DM3 1980..2033 CDD:128933
DM3 2147..2202 CDD:128933
DM3 2308..2365 CDD:128933
DM3 2434..2491 CDD:128933
DM3 2539..2598 CDD:128933
DM3 2622..2680 CDD:128933
DM3 2718..2775 CDD:128933
DM3 2907..2965 CDD:128933
DM3 3098..3155 CDD:128933
DM3 3227..3284 CDD:128933
DM3 3396..3452 CDD:128933
DM3 3544..3601 CDD:128933
THAP 3621..>3669 CDD:283206
DM3 3690..3748 CDD:128933
Zfp667NP_001020099.1 KRAB 14..74 CDD:214630
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..140
COG5048 141..600 CDD:227381 72/299 (24%)
C2H2 Zn finger 146..166 CDD:275368
C2H2 Zn finger 174..194 CDD:275368
C2H2 Zn finger 202..222 CDD:275368
C2H2 Zn finger 255..275 CDD:275368
C2H2 Zn finger 331..351 CDD:275368 3/14 (21%)
C2H2 Zn finger 359..379 CDD:275368 4/20 (20%)
C2H2 Zn finger 387..407 CDD:275368 7/24 (29%)
C2H2 Zn finger 416..436 CDD:275368 6/19 (32%)
C2H2 Zn finger 444..464 CDD:275368 7/19 (37%)
C2H2 Zn finger 472..492 CDD:275368 4/19 (21%)
C2H2 Zn finger 500..520 CDD:275368 7/23 (30%)
C2H2 Zn finger 528..548 CDD:275368 2/19 (11%)
C2H2 Zn finger 556..576 CDD:275368 5/24 (21%)
C2H2 Zn finger 584..604 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846721
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.