DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10631 and Zfp524

DIOPT Version :9

Sequence 1:	NP_609998.1	Gene:	CG10631 / 35262	FlyBaseID:	FBgn0032817	Length:	3781	Species:	Drosophila melanogaster
Sequence 2:	NP_001102375.1	Gene:	Zfp524 / 365179	RGDID:	1565485	Length:	314	Species:	Rattus norvegicus

Alignment Length:	101	Identity:	27/101 - (26%)
Similarity:	41/101 - (40%)	Gaps:	0/101 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   319 CSTCPMSFMTTEELQRHKLHHRADRFFCHKYCGKHFDTIAECEAHEYMQHEYDSFVCNMCSGTFA 383
            |..|..:|....:|:||.:.|...:....|.|||.|...:....|..:......|.|.:|...|.
  Rat   111 CPVCLRAFPYLSDLERHSISHSELKPHVCKDCGKTFKRSSHLRRHCNIHAGLRPFRCVLCPRRFR 175

  Fly   384 TREQLYAHLPQHKFQQRFDCPICRLWYQTALELHEH 419
            ...:|..|...|..::.:.||.||:.:..|..|..|
  Rat   176 EAGELAHHHRIHSGERPYQCPSCRVRFTEANTLRRH 211

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10631	NP_609998.1	C2H2 Zn finger	288..311	CDD:275368
		C2H2 Zn finger	319..339	CDD:275368	6/19 (32%)
		DM3	584..642	CDD:128933
		DM3	683..738	CDD:128933
		DM3	775..832	CDD:128933
		DM3	945..1000	CDD:128933
		DM3	1038..1096	CDD:128933
		DM3	1145..1198	CDD:128933
		THAP	1236..1308	CDD:214951
		DM3	1349..1406	CDD:128933
		THAP	1424..1493	CDD:214951
		DM3	1538..1596	CDD:128933
		DM3	1683..1739	CDD:128933
		DM3	1778..1831	CDD:128933
		DM3	1980..2033	CDD:128933
		DM3	2147..2202	CDD:128933
		DM3	2308..2365	CDD:128933
		DM3	2434..2491	CDD:128933
		DM3	2539..2598	CDD:128933
		DM3	2622..2680	CDD:128933
		DM3	2718..2775	CDD:128933
		DM3	2907..2965	CDD:128933
		DM3	3098..3155	CDD:128933
		DM3	3227..3284	CDD:128933
		DM3	3396..3452	CDD:128933
		DM3	3544..3601	CDD:128933
		THAP	3621..>3669	CDD:283206
		DM3	3690..3748	CDD:128933
Zfp524	NP_001102375.1	COG5048	<102..218	CDD:227381	27/101 (27%)
		C2H2 Zn finger	111..131	CDD:275368	6/19 (32%)
		zf-H2C2_2	123..148	CDD:290200	9/24 (38%)
		C2H2 Zn finger	139..159	CDD:275368	6/19 (32%)
		zf-H2C2_2	151..174	CDD:290200	4/22 (18%)
		C2H2 Zn finger	167..187	CDD:275368	5/19 (26%)
		zf-H2C2_2	179..203	CDD:290200	7/23 (30%)
		C2H2 Zn finger	195..216	CDD:275368	7/17 (41%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24390
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100