DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10631 and CG17568

DIOPT Version :9

Sequence 1:NP_609998.1 Gene:CG10631 / 35262 FlyBaseID:FBgn0032817 Length:3781 Species:Drosophila melanogaster
Sequence 2:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster


Alignment Length:399 Identity:82/399 - (20%)
Similarity:127/399 - (31%) Gaps:118/399 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 PYIKSEPMEAYQQPPN-----PMAPPPAPEVLIKSEPIDEHSY-----------KSNYID----- 232
            |.::.|....||:|..     |:|...:.|:.|.......|..           |..:||     
  Fly   124 PALEMESDNVYQKPAELLKDFPLAETSSQEMEISKRTTTTHLIQTKKNVEMEIPKQEFIDLGPIL 188

  Fly   233 --DNTPFADFSK-FSEFSEDMLS-PKVELTVKDESYGRTTSSFLRRKQQSDRGNESLPI------ 287
              .||...|... ..|..::.|| |:::.|....|......|.:....:.|  ::.||:      
  Fly   189 LEKNTSQLDMEDVLDELPQEELSQPRLDSTTSPASMENDVKSEMLDSCEGD--DDFLPVDGQLMD 251

  Fly   288 -------------------------CQRCKEVFFKKQVYLRHVAESNC----------------- 310
                                     |::|.:|:..:..|.:|: |..|                 
  Fly   252 LVAVATTPNTLESTAEEKAKRGRMDCEKCGKVYRNRASYEKHL-ERECRRIERRVKVDKTTTTCD 315

  Fly   311 -----------------GIQE--YDFKCSTCPMSFMTTEELQRHKLHHRADRFFCHKYCGKHFDT 356
                             ||.:  ..:.|.:|.....|...|..|||.|...|.|....|...|..
  Fly   316 ICNKTLSSATALKLHKEGIHQNVKPYICDSCGKQLKTITALNEHKLVHTESRPFECTVCKAGFKN 380

  Fly   357 IAECEAHEYMQHEYDSFVCNMCSGTFATREQLYAHLPQHKFQQRFDCPICRLWYQTALELHEHRL 421
            .|..:|| |..|...|||||:|.....||.....|...|..::|..|.:|...::.:..|..|.|
  Fly   381 RARLKAH-YQIHAEPSFVCNICGKKLQTRRTWNMHKVVHTEERRLKCDVCGALFKRSKTLKTHLL 444

  Fly   422 A----APYFCGKYYTGGQSSSASQSQAQQHQTNYKLQDCHMATMEMPTTPHHKTTPSGSSLPATA 482
            :    .||.|.  |.|  .|.|..:..:.|              ::...|.......|:.||:..
  Fly   445 SHTGLRPYVCN--YCG--KSFACNANCRSH--------------KLKKHPQEVQQEDGARLPSRL 491

  Fly   483 ALNSLLQQR 491
            .:.:|.:.|
  Fly   492 NVPTLDELR 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10631NP_609998.1 C2H2 Zn finger 288..311 CDD:275368 7/56 (13%)
C2H2 Zn finger 319..339 CDD:275368 7/19 (37%)
DM3 584..642 CDD:128933
DM3 683..738 CDD:128933
DM3 775..832 CDD:128933
DM3 945..1000 CDD:128933
DM3 1038..1096 CDD:128933
DM3 1145..1198 CDD:128933
THAP 1236..1308 CDD:214951
DM3 1349..1406 CDD:128933
THAP 1424..1493 CDD:214951
DM3 1538..1596 CDD:128933
DM3 1683..1739 CDD:128933
DM3 1778..1831 CDD:128933
DM3 1980..2033 CDD:128933
DM3 2147..2202 CDD:128933
DM3 2308..2365 CDD:128933
DM3 2434..2491 CDD:128933
DM3 2539..2598 CDD:128933
DM3 2622..2680 CDD:128933
DM3 2718..2775 CDD:128933
DM3 2907..2965 CDD:128933
DM3 3098..3155 CDD:128933
DM3 3227..3284 CDD:128933
DM3 3396..3452 CDD:128933
DM3 3544..3601 CDD:128933
THAP 3621..>3669 CDD:283206
DM3 3690..3748 CDD:128933
CG17568NP_609951.2 zf-AD 10..87 CDD:214871
COG5048 <313..471 CDD:227381 43/176 (24%)
C2H2 Zn finger 314..335 CDD:275368 1/20 (5%)
C2H2 Zn finger 343..363 CDD:275368 7/19 (37%)
C2H2 Zn finger 371..391 CDD:275368 6/20 (30%)
C2H2 Zn finger 398..418 CDD:275368 6/19 (32%)
C2H2 Zn finger 426..446 CDD:275368 5/19 (26%)
zf-H2C2_2 439..463 CDD:290200 9/27 (33%)
C2H2 Zn finger 454..475 CDD:275368 6/38 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.