DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10631 and CG3407

DIOPT Version :9

Sequence 1:NP_609998.1 Gene:CG10631 / 35262 FlyBaseID:FBgn0032817 Length:3781 Species:Drosophila melanogaster
Sequence 2:NP_608809.1 Gene:CG3407 / 33606 FlyBaseID:FBgn0031573 Length:714 Species:Drosophila melanogaster


Alignment Length:576 Identity:114/576 - (19%)
Similarity:182/576 - (31%) Gaps:148/576 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQQHPH-------------------HAHPHHYAH---HYPPPVTPMSLQQQQQQQQHQQAQ--- 40
            :..||.|                   |.....:||   ||.|.|....|..|..||||||.:   
  Fly   150 LDHQHKHVQDVAPSSLYSCEICGYAVHTQLDFFAHLKQHYEPTVLEQRLVVQDPQQQHQQKEPLD 214

  Fly    41 ---LSPQQQQQQ------------------------HANWYSHVASYPTPHSAFGPAPAPSCKAA 78
               ||.|.:.||                        |.|..::|......|   |.|........
  Fly   215 MCGLSAQDKLQQEQAKLDQVFQDVQLNFENFHNISHHVNDVANVGVNMVLH---GQATDKLNAVV 276

  Fly    79 NNSGSGNNNNNIMGGGGYGPGGGGAQGYYGAAGGGLNVSGAV----------------VGGGGPN 127
            .|:.|..|:..::....:.......:|.       .||...|                .|...|.
  Fly   277 VNTSSTPNSVPVVDDVEFSDTEDMLEGI-------RNVVDKVSIEDTCDELVDLELTSSGMTAPW 334

  Fly   128 YGLGANTVAYAHNQLLQYQQQQQQQQQQQQQQQQQHQHQHL------PQHISQQRPYMGHNIMTG 186
            :......:.:....|.........:......::..|...|:      |:....|........::.
  Fly   335 FNNNFRDITFPALLLPGEPPPASSEPATPLLKENPHVGDHMALDFLSPEKADPQEEAKLEKTLSK 399

  Fly   187 SYPYIKSEPME--------AYQQPPNPMAPPPAPEV-LIKSEPID-EHSYKSNYIDDNTPFADFS 241
            :     .||.|        |.|.||.|..||....: .::..|:: ..::|... ||.|.....|
  Fly   400 A-----CEPNEQTLLVAPPACQTPPIPTVPPANSSIEQLRRSPLELSEAFKLEE-DDMTDSRPAS 458

  Fly   242 KFSEFSEDMLSPK--VELTVKDESYGRTTSSFLRRKQQSDRGN------------------ESLP 286
            .|.|...|...|.  .::.|.|.|......:..|||...|:.|                  |...
  Fly   459 SFEEGDPDAEEPNECFQMEVLDTSLTEEAENKTRRKHFCDKCNRDFNSYNALKYHQYTHNQERSH 523

  Fly   287 ICQRCKEVFFKKQVYLRHVAESNCGIQEYDFKCSTCPMSFMTTEELQRHKLHHRAD--RFFCHKY 349
            .|..|:..|:.:.....| ..::.|::  .|||..|...|....:|:.|.:...:|  ...| ::
  Fly   524 KCDSCERSFYTQSALKAH-ERTHSGVK--PFKCDKCEFQFRQWGDLKYHIISRHSDVKAHMC-EF 584

  Fly   350 CGKHFDTIAECEAHEYMQHEYDSFVCNMCSGTFATREQLYAHLPQHKFQQRFDCPICRLWYQTAL 414
            |||.|........|..:.....::.|..|..||.....|.:|:..|..::.::|.||...::.:.
  Fly   585 CGKSFSRRYSLVVHRRIHTREKNYACQYCDKTFRASSYLLSHIKVHTGERPYECSICEKKFRVSG 649

  Fly   415 ELHEH-RLAAPYFCGKYYTGGQSSSASQSQAQQHQ------TNYKL---QDCHMAT 460
            :|..| |:..|            |..||..|::.:      :|.:|   :|..:||
  Fly   650 DLKRHSRIHDP------------SRTSQPPAEKAKKKRAAASNKQLPIEEDDELAT 693

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10631NP_609998.1 C2H2 Zn finger 288..311 CDD:275368 4/22 (18%)
C2H2 Zn finger 319..339 CDD:275368 5/19 (26%)
DM3 584..642 CDD:128933
DM3 683..738 CDD:128933
DM3 775..832 CDD:128933
DM3 945..1000 CDD:128933
DM3 1038..1096 CDD:128933
DM3 1145..1198 CDD:128933
THAP 1236..1308 CDD:214951
DM3 1349..1406 CDD:128933
THAP 1424..1493 CDD:214951
DM3 1538..1596 CDD:128933
DM3 1683..1739 CDD:128933
DM3 1778..1831 CDD:128933
DM3 1980..2033 CDD:128933
DM3 2147..2202 CDD:128933
DM3 2308..2365 CDD:128933
DM3 2434..2491 CDD:128933
DM3 2539..2598 CDD:128933
DM3 2622..2680 CDD:128933
DM3 2718..2775 CDD:128933
DM3 2907..2965 CDD:128933
DM3 3098..3155 CDD:128933
DM3 3227..3284 CDD:128933
DM3 3396..3452 CDD:128933
DM3 3544..3601 CDD:128933
THAP 3621..>3669 CDD:283206
DM3 3690..3748 CDD:128933
CG3407NP_608809.1 COG5048 <494..656 CDD:227381 35/165 (21%)
C2H2 Zn finger 497..517 CDD:275368 2/19 (11%)
zf-H2C2_2 509..534 CDD:290200 4/24 (17%)
C2H2 Zn finger 525..545 CDD:275368 4/20 (20%)
zf-H2C2_2 537..562 CDD:290200 7/27 (26%)
C2H2 Zn finger 555..574 CDD:275371 4/18 (22%)
zf-C2H2 580..602 CDD:278523 6/22 (27%)
C2H2 Zn finger 582..602 CDD:275368 6/20 (30%)
zf-H2C2_2 594..617 CDD:290200 3/22 (14%)
C2H2 Zn finger 610..630 CDD:275368 6/19 (32%)
zf-H2C2_2 622..645 CDD:290200 6/22 (27%)
zf-C2H2 636..658 CDD:278523 6/21 (29%)
C2H2 Zn finger 638..658 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.