DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10631 and Thap6

DIOPT Version :10

Sequence 1:NP_609998.1 Gene:CG10631 / 35262 FlyBaseID:FBgn0032817 Length:3781 Species:Drosophila melanogaster
Sequence 2:NP_001100679.1 Gene:Thap6 / 305244 RGDID:1310094 Length:216 Species:Rattus norvegicus


Alignment Length:250 Identity:53/250 - (21%)
Similarity:87/250 - (34%) Gaps:81/250 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1130 CVETCKRNPSVDDIKLYRPPEEASVLAKWA---HNLQTESSQLTSMR----ICNLHFEAHCIGK- 1186
            |...|..|..:..:..:..|.:.::..||.   ..|...::.:...:    :|:.||:.....: 
  Rat    10 CASRCLPNSKLKGLTFHVFPTDENIKRKWVLAMKRLDVNTAGIWEPKKGDVLCSRHFKKTDFDRS 74

  Fly  1187 ----RMRPWAIPTLNLAGTIENLYENPEHSMLYKRRTHMKAKQSASVKPTWVPRCCLPHCRKVRA 1247
                :::|.|||         :::|:|.|  |.::|..:                   ||||   
  Rat    75 TPNTKLKPGAIP---------SVFESPCH--LQEKREKL-------------------HCRK--- 106

  Fly  1248 LHNVQLYRFPKLNRSTLAKWAHNLQVPMVGSAQRRLCSAHFEPHVLSKKCPVPLAVPTLDLNAPP 1312
              |..|...|..||      .|.|    ||::    |.|.|:|.::.:.                
  Rat   107 --NFILKTLPVSNR------GHQL----VGAS----CIAEFQPQLIFEH---------------- 139

  Fly  1313 GLKIYQNPAKLKASKLCLQRVCIVESCRKTRAQGVQLFRLPHSPTQLRKWMHNIK 1367
            ...:..:|.|||..   |..|.|.....|...|.| |.|..|....|||.:..:|
  Rat   140 SYSVMDSPKKLKHK---LDLVIIELENTKESLQNV-LDREKHFQKSLRKTIRELK 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10631NP_609998.1 C2H2 Zn finger 288..311 CDD:275368
C2H2 Zn finger 319..339 CDD:275368
DM3 584..642 CDD:128933
DM3 683..738 CDD:128933
DM3 775..832 CDD:128933
DM3 945..1000 CDD:128933
DM3 1038..1096 CDD:128933
DM3 1145..1198 CDD:128933 11/64 (17%)
THAP 1236..1308 CDD:214951 17/71 (24%)
DM3 1349..1406 CDD:128933 6/18 (33%)
THAP 1424..1493 CDD:214951
DM3 1538..1596 CDD:128933
DM3 1683..1739 CDD:128933
DM3 1778..1831 CDD:128933
DM3 1980..2033 CDD:128933
DM3 2147..2202 CDD:128933
DM3 2308..2365 CDD:128933
DM3 2434..2491 CDD:128933
DM3 2539..2598 CDD:128933
DM3 2622..2680 CDD:128933
DM3 2718..2775 CDD:128933
DM3 2907..2965 CDD:128933
DM3 3098..3155 CDD:128933
DM3 3227..3284 CDD:128933
DM3 3396..3452 CDD:128933
DM3 3544..3601 CDD:128933
THAP 3622..>3673 CDD:461662
DM3 3690..3748 CDD:128933
Thap6NP_001100679.1 THAP 4..89 CDD:214951 14/87 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.